KEGG   Naumovozyma castellii: NCAS_0I01510Help
Entry
NCAS_0I01510      CDS       T02233                                 

Gene name
NCAS0I01510
Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ncs  Naumovozyma castellii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NCAS_0I01510 (NCAS0I01510)
Enzymes [BR:ncs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     NCAS_0I01510 (NCAS0I01510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(279933..282713)
Genome map
AA seq 926 aa AA seqDB search
MSLPKYQNKPFKPPRRLISAQANSNSPLNSTKRLPSDNFANETTSKRIKVPPSKEPVTTS
NTGGDNGTKCFTIMYRKPSMKKHKTWDNDGYAQLRTSNNLILFNDAGTKIGNRHLTNDSE
LCDFIFKAGSWEVQVDYELSDPKELQRVRSLLCKNNQATVTPPSSARTNGNAITKSVTQN
KIPVSQLFNSQTVTKFKTIMKKSDAHTPLSSSKQNEITSKKKKYQPVFDVSKIENPIIMN
KWRDADVDVIVDPLLGKLLRPHQREGVKFMYDCVMGLATNHQETDEDNTGKSLILEKDSD
IGGCLLADEMGLGKTLMTITLIWTLLKQSPSLKNIACSQSGVPLHGLCRKILVVCPVTLI
GNWKREFAKWLNLNRIGILTLSSRNTPEMDKTAVKNFLRVQRTFQVLVIGYEKLLSVSEE
LHGSRDLIDLLICDEGHRLKNGSSKVLNVLKNLEIKRKILLSGTPIQNDLNEFYTIIDFL
NPGILGSYPYFKKRFIAPITRGRDTENRHNEDIIELGEGRSKEMIDITRKFTLRRTNAIL
SKYLPPKTDIILFCKPTQSQLLAFNDILSRSRIDFANLSFNSSLGLITLFKKICNSPTLI
GDDSYYQSKIRPDGVIQERYDRSLNSGKLKILMTLLEKIKGNTNNEKVVIVSNYTQTLDI
IQNLMNSAQMVSCRLDGSTPAKQRDSIVNTFNRNPSIFAFLLSAKSGGVGLNLIGASRLI
LFDNDWNPSIDLQAMSRIHRDGQKKHCYIYRLITTGCIDEKILQRQLMKHSLSKKFLDSS
YTTGKTGSNDDLFTKEDLKDLFTIMETTKSNTHDLICDCEGTGKSVSLNEIAHPKKKNLE
KRRNSWTNALQLSQVMEDDEMKNMQQKTNLMKECFVGYKHIDPLKTNELADNVTSNTLKT
MKEWITFAFINDEKVDSTKEDIIILD
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgtcactacccaaataccaaaataagcccttcaaaccacctcggagactaatatcggct
caagcaaactccaactcaccattaaatagtaccaaacgactccccagtgacaactttgcc
aatgaaaccacatccaagagaataaaagtaccgccatccaaggaaccggtaacaacaagt
aataccggaggcgataatggcaccaagtgttttacaataatgtatcggaaaccgtcaatg
aaaaaacacaagacatgggataatgacggatatgcacagcttaggacatccaacaacctt
atcctctttaatgatgctgggactaagattggtaatcgtcaccttacgaatgattctgag
ttatgtgattttatttttaaagctggatcatgggaagttcaagtggattatgaattatcg
gaccctaaagagttacaaagggtccgttctttattatgcaaaaataatcaagcaacagtt
actcccccatcttctgctaggactaacggtaatgctatcactaagtcagttacacaaaat
aagattccagtttctcagttatttaattcgcaaactgtaacaaaatttaaaacaataatg
aagaaatctgatgctcataccccactatcctcctctaaacaaaatgaaattacttctaag
aaaaagaaatatcaaccagtgtttgatgtatcaaagatagaaaaccccatcattatgaac
aagtggagggatgccgacgttgatgtcatagtagatccattattggggaaattattgaga
ccacatcaaagagagggtgtaaagttcatgtatgattgcgtaatgggtctagcgaccaat
catcaagaaacagatgaagataatacagggaaatctttgatcttggagaaggattctgat
attggtggatgtctattagcagatgaaatgggattgggcaaaacattgatgaccataaca
ttaatatggacacttttgaaacaatcaccaagtttgaaaaacattgcctgttcacaatct
ggcgtaccattacatggactatgtaggaaaatattggtagtctgtccagtgacgcttatt
ggtaattggaaaagagagtttgcaaaatggttgaatttaaatagaattggaatactcact
ttaagctcccgaaatactccggaaatggataaaaccgccgtaaagaatttcctccgagtt
caaaggacattccaggttctagtgataggttatgaaaaattattaagtgtttctgaagaa
ctacacggctcaagagacttgattgatttgcttatctgtgatgaagggcataggttgaaa
aacgggtcttccaaggtattaaatgtattgaaaaatcttgaaattaaaaggaaaattctt
ctttcaggtactcctattcaaaatgatctcaatgaattctatactataattgatttcctt
aaccctggaattcttggatcatatccttatttcaagaaaaggttcatagcgcctattacg
agaggaagggacacagaaaatagacacaatgaagatattatcgaacttggtgagggtaga
tcaaaggaaatgattgatataacaagaaaatttaccttaagaagaacaaatgctattctc
agtaaatatttgccccccaaaacggatatcattctattttgcaagccgacacaatcacaa
cttttggcctttaatgatatcctgagtagatcaaggatagattttgccaatctatctttt
aattcatcattggggctcattacccttttcaagaaaatttgcaactccccaacattaatt
ggtgatgatagttactaccagtcaaagattagacctgatggtgtaatccaggaaaggtat
gatcgttctttaaattctggaaaattaaaaatcctaatgacacttttagaaaaaattaaa
ggtaataccaacaatgagaaagttgtcatcgtttccaactatacacaaacccttgatata
atccaaaatctaatgaattcagcacaaatggtatcttgccgattagatggttcaacgcca
gcgaaacaaagagattccatagtgaatacatttaatagaaatccctctatttttgcgttc
ttattaagtgcgaaatcaggtggggtaggtttgaatttaataggtgcgtctcgtctaatt
ctttttgataatgactggaacccatccattgacttgcaagctatgtctagaatccataga
gatggacagaaaaagcattgttatatatatagattaataacaacaggatgcatagatgaa
aagattctgcagcgacaattaatgaaacatagtttgagcaaaaaatttctagattcatca
tacacgaccggaaagacgggatctaatgatgacttatttactaaagaagatttgaaagat
ttattcaccattatggaaaccactaagagtaatactcatgatttaatttgtgactgtgag
ggtacaggtaaaagcgtgtcacttaatgaaatagctcatccaaagaagaagaatttagag
aaaaggcgtaacagctggaccaatgccttgcaattatcacaggtaatggaggatgatgag
atgaagaatatgcaacagaaaacaaatctaatgaaagaatgtttcgtcggttataaacat
attgaccctctgaaaacaaatgaattggctgacaatgtgacttcgaatacgttaaaaact
atgaaagaatggataacatttgcctttataaatgatgaaaaagttgatagtacaaaggag
gatatcataattctagattaa

DBGET integrated database retrieval system