KEGG   Naumovozyma castellii: NCAS_0I01620Help
Entry
NCAS_0I01620      CDS       T02233                                 

Gene name
NCAS0I01620
Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ncs  Naumovozyma castellii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:complement(299269..301656)
Genome map
AA seq 795 aa AA seqDB search
MEEQVFTNLAVPTSIAKDQCIYCFESLYNNITATFNTTHSLDICISCFQATCPNHSLLHY
KVTQHSSDSPHGHYLNLSKWERPASSPSSASMNNDESNNKKIKLQIDTKSEDELYETKWS
FQKISTDGSLLEPLFDNNTNTETLSSNTLNKINDIIRAKSKTLVEETQSWELELNSCSHT
RSLQSGESSISPTPAALDHCHDCDLDSNLWLCLHCGNVGCGRNQVGIDGNSHALAHFDTH
KDHPLAIKLGSLSPESSDVYCYQCNDEVRFDGDKDFLAKFLLTNYQIDVSSKMGTEKSLI
ELQVEQNMNWNFKMVDSHGNELIQLPPSKELGCGFINLGNSCYLNSVLQCLFNDGVPNWA
TLLANLIGNEFPLDCVYPTTNLKCQLIKILNAFKLNPENYPEGIKPQSFKNYVGQSNKEF
KSNNQQDATEFLTFLLEQLEKTLFKKDNNPNNIMKFIMEDKIQCQSCGNVKYSYEPTEYI
QLPLDGTNNPQNLVETLTNFFNGENIDFDCPTCKKTVVATKRQRFKTSPNTLVISPHRIS
FEKETWTPIKTSAELTLPNLDDSSNELLDLSSFISKGFDPTKETLFPEDVNEDNNTFKPN
EQAVPPLLEMGFTENLAAKALYHTGNNNDPEPALQWLMQHMDDSDFQDEFVPPPQTKAAG
PAAKVDQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSETTPKRD
EEGIIYGNLDAKPYRLTAVVCHKGNSAHSGHYVAFIRKMIDDELKWVLYNDEKIVVSDNI
DEIKKDGYIYFYSRD
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacaagtatttacaaacctcgcagttcctacttccatcgcaaaggatcaatgt
atatactgtttcgaatcactatacaataacatcaccgccacttttaacaccacacattcc
ttagatatctgtatctcatgtttccaggctacttgtcccaaccattcattattacattat
aaagtcactcagcactcatctgattcaccacatgggcattatttgaatctatctaaatgg
gaaagaccggcctcttcaccatcttctgcgtccatgaacaatgatgaatcaaacaataag
aagataaaattacaaatagatacgaaatcagaagatgaattgtatgaaaccaaatggtca
ttccaaaagataagtacggatggttctttattggaacctttatttgacaataataccaat
actgaaacgttgtcgtctaataccttaaacaagattaatgatataatcagggctaaatct
aagactcttgtcgaggaaactcaatcatgggagcttgaactaaattcctgctctcataca
agatccttacaatcaggtgaatccagcatttcccccacaccagctgctttggaccattgt
catgattgtgatttggattctaacctgtggttatgtttacattgtgggaatgtaggttgc
ggtaggaatcaagtcggtatcgatggaaattcacacgccttggcgcatttcgatacacat
aaggatcacccattagccattaaattgggttcactttcacctgaatcgagcgatgtctat
tgttaccaatgtaatgatgaagtcagatttgatggtgataaggatttcttagcaaagttt
ttattaacaaattaccaaattgacgtttcttcaaagatggggacggaaaaatcattaatt
gaattacaggtggaacaaaatatgaattggaatttcaaaatggtggattctcatggaaat
gagttgattcaattacctccaagcaaggaattaggatgtgggtttattaatttgggtaat
tcatgttatttaaattctgttctacaatgtttattcaatgatggggttccaaattgggcc
actttactagccaatttaattggtaatgaattccctctggattgcgtatatccaacaact
aacttaaaatgtcaattaattaagattttgaatgcatttaaattgaatccagagaattat
ccagaaggtattaaaccacaatcctttaaaaattatgtgggtcaatcaaataaagaattt
aaatctaataatcagcaggatgcaacagagttcttaacattcttattggaacaattagag
aaaactctttttaagaaagataataatccaaataatataatgaaatttattatggaggat
aagattcaatgccaatcatgtgggaatgtaaaatattcatatgaacccacagaatacatt
cagttaccactagatggaactaataaccctcaaaatttagtggaaaccttaactaatttc
ttcaatggagaaaatattgattttgattgtcccacatgtaaaaaaactgttgttgccacc
aagagacaaagatttaaaacaagtccaaatactttagtgattagtcctcatagaataagt
tttgagaaggaaacctggacccccataaagacctctgcagaattgacgcttcctaacttg
gatgattccagcaatgagcttttagatttatcatcatttatctctaagggatttgaccct
accaaggaaacattgttcccagaagatgtaaatgaggataataacacttttaaaccaaac
gaacaagctgttcctcctttattggagatgggatttaccgaaaatcttgctgcaaaggcc
ttataccatacggggaataataatgatcctgaaccagcattacaatggttaatgcaacat
atggatgattctgattttcaagatgaatttgttccaccaccacaaacgaaggcagcaggt
cctgcagccaaagtggatcaagaatcattgagtaatatgattgacatgggattgaatgaa
aaactttccataaaggctttggttttaaataagggagatatcaatgcaagcattgaatgg
gtatttaataatccagacgataatggtgaactaccttcagaaacaacacctaaaagggac
gaggaagggattatatatgggaatcttgatgcaaaaccttatcgattgaccgctgtggtc
tgtcacaagggtaactccgctcattctggtcactatgtggcatttattagaaaaatgatt
gatgatgaattgaaatgggtattatacaatgatgagaaaattgtagtaagtgataatatt
gatgaaattaaaaaggatggatatatatatttctattcgagagattag

DBGET integrated database retrieval system