KEGG   Naumovozyma castellii: NCAS_0I01720Help
Entry
NCAS_0I01720      CDS       T02233                                 

Gene name
NCAS0I01720
Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NCAS_0I01720 (NCAS0I01720)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0I01720 (NCAS0I01720)
  Lipid metabolism
   00071 Fatty acid degradation
    NCAS_0I01720 (NCAS0I01720)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCAS_0I01720 (NCAS0I01720)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NCAS_0I01720 (NCAS0I01720)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:318144..319199
Genome map
AA seq 351 aa AA seqDB search
MSSPVIPKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPL
DTKLPLVGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNADL
SGYTHDGSFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVYKALKSANLRAGEWVAIS
GACGGLGSLCIQYANAMGYRVLGIDGGDDKAKLFKQLHGEVFIDFTKTKDVISEVNKVTN
GGAHGVINVSVSEAAIEASTKYCRANGTVVLVGLPGGAKCKSDVFNQVVKSMTIVGSYVG
NRADTREALDFFTRGLVKAPIHVAPLSTLPTIFEKMEKGQIVGRYVVDTSR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctccagttatcccaaaaacccaaaaagcaattatttttgaatctaacggaggt
ccactagagtacaaagatatcccagttccaaccccaaagtctaacgaaattttggtcaac
atcaaatattctggtgtctgtcacacagacttacatgcctggaagggtgactggccctta
gataccaaattaccattggttggaggtcacgaaggtgctggtattgtcgtcgctattggt
gacaatgtcaagggctggaaaattggtgattatgctggtgtaaaatggttgaatggctct
tgtatggcatgcgaatactgtgaattggggaacgaatcaaattgtccaaatgctgatttg
tcaggttacactcacgatggttctttccaacaatatgctacagctgatgctgttcaggct
gctagaattccagccggaacaaacttgtcagaagtagctccaatcctatgtgctggtatg
acagtctacaaggctttgaaatctgctaatttgagggctggagaatgggttgccatttct
ggtgcttgtggtgggttaggttctttatgtatccaatatgcaaacgctatgggttataga
gtattaggtatcgatggtggtgatgataaggccaaactattcaagcaactacatggtgaa
gtcttcattgattttacgaagactaaggatgtcatttctgaagttaacaaggttactaat
ggtggtgctcatggtgtcatcaatgtgtctgtttctgaagcggcaattgaagcctccacc
aaatactgtagagctaacggtactgttgtcttagttggtttgcctggtggtgccaagtgt
aaatctgatgtctttaatcaagttgttaagtctatgacaattgttggctcttacgttgga
aatagagctgatacaagagaagctttggacttcttcactagaggtttggttaaggctcca
atccatgtggctcccttgtccaccttaccaacaatatttgaaaaaatggaaaagggtcaa
attgttggtagatatgttgttgatacatctagatag

DBGET integrated database retrieval system