KEGG   Naumovozyma castellii: NCAS_0I01720Help
Entry
NCAS_0I01720      CDS       T02233                                 

Gene name
NCAS0I01720
Definition
(RefSeq) hypothetical protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ncs  Naumovozyma castellii
Pathway
ncs00010  Glycolysis / Gluconeogenesis
ncs00071  Fatty acid degradation
ncs00350  Tyrosine metabolism
ncs01100  Metabolic pathways
ncs01110  Biosynthesis of secondary metabolites
ncs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCAS_0I01720 (NCAS0I01720)
  Lipid metabolism
   00071 Fatty acid degradation
    NCAS_0I01720 (NCAS0I01720)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NCAS_0I01720 (NCAS0I01720)
Enzymes [BR:ncs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NCAS_0I01720 (NCAS0I01720)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 DapB_N
Motif
Other DBs
NCBI-GeneID: 11525433
NCBI-ProteinID: XP_003678182
UniProt: G0VK06
Position
9:318144..319199
Genome map
AA seq 351 aa AA seqDB search
MSSPVIPKTQKAIIFESNGGPLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPL
DTKLPLVGGHEGAGIVVAIGDNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCPNADL
SGYTHDGSFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVYKALKSANLRAGEWVAIS
GACGGLGSLCIQYANAMGYRVLGIDGGDDKAKLFKQLHGEVFIDFTKTKDVISEVNKVTN
GGAHGVINVSVSEAAIEASTKYCRANGTVVLVGLPGGAKCKSDVFNQVVKSMTIVGSYVG
NRADTREALDFFTRGLVKAPIHVAPLSTLPTIFEKMEKGQIVGRYVVDTSR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctccagttatcccaaaaacccaaaaagcaattatttttgaatctaacggaggt
ccactagagtacaaagatatcccagttccaaccccaaagtctaacgaaattttggtcaac
atcaaatattctggtgtctgtcacacagacttacatgcctggaagggtgactggccctta
gataccaaattaccattggttggaggtcacgaaggtgctggtattgtcgtcgctattggt
gacaatgtcaagggctggaaaattggtgattatgctggtgtaaaatggttgaatggctct
tgtatggcatgcgaatactgtgaattggggaacgaatcaaattgtccaaatgctgatttg
tcaggttacactcacgatggttctttccaacaatatgctacagctgatgctgttcaggct
gctagaattccagccggaacaaacttgtcagaagtagctccaatcctatgtgctggtatg
acagtctacaaggctttgaaatctgctaatttgagggctggagaatgggttgccatttct
ggtgcttgtggtgggttaggttctttatgtatccaatatgcaaacgctatgggttataga
gtattaggtatcgatggtggtgatgataaggccaaactattcaagcaactacatggtgaa
gtcttcattgattttacgaagactaaggatgtcatttctgaagttaacaaggttactaat
ggtggtgctcatggtgtcatcaatgtgtctgtttctgaagcggcaattgaagcctccacc
aaatactgtagagctaacggtactgttgtcttagttggtttgcctggtggtgccaagtgt
aaatctgatgtctttaatcaagttgttaagtctatgacaattgttggctcttacgttgga
aatagagctgatacaagagaagctttggacttcttcactagaggtttggttaaggctcca
atccatgtggctcccttgtccaccttaccaacaatatttgaaaaaatggaaaagggtcaa
attgttggtagatatgttgttgatacatctagatag

DBGET integrated database retrieval system