KEGG   Naumovozyma castellii: NCAS_0I02080Help
Entry
NCAS_0I02080      CDS       T02233                                 

Gene name
NCAS0I02080
Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ncs  Naumovozyma castellii
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ncs00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NCAS_0I02080 (NCAS0I02080)
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NCAS_0I02080 (NCAS0I02080)
Protein kinases [BR:ncs01001]
 Serine/threonine protein kinases: Other group
  TTK family
   NCAS_0I02080 (NCAS0I02080)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:390551..392875
Genome map
AA seq 774 aa AA seqDB search
MAKYSYHSRLSIHRREPLQNLGTNIEPDDSDDEKVSGPPVLSNFASAFLSEGDKNTSNIR
EEETNVFNNSNMKLSQTPNNSIEPNQADDLSLHSTLFANTVGNRQSSLTTMNSTNNFALN
HDTNKEHTVFEDNLQKIKSLQQTMKEELTSRYIERRNKRFLTSRRNNLGPAKRASTSAIS
ASTEDRYQENDKHSNNEKYSTQDDSNILAKQVGRLSSPLNRQNRAFQSSNGDDTNMKEPV
DYSSIEFGELTPFEYLKKHDLPTSELPYISRIYFEKQKLENRQTVLRKRRFSSKESLSLG
TTSSLAPYSNSKNNTTNQVSRDLSLPRRKISDTSSKISKQILKSNINLSESGSHGFPPDL
QSIQRQHESAEKLSRAPLIDLNVNNVSPKRMDKLRETHKFSDSRLNVQDFSKKTDVVVYE
KQAPRKKVEIVEPKRSHSKLAKRNTITVNDTEYEKIELLGRGGSSRVYKVKNSQNKVFAL
KRVSFDEFDDSSVDGFKGEIELLEKLSNESRVVKLFDYQMDSGVLFLIMECGDHDLSQIL
SQRSDMPLDMDFVRYHAREVVRCIKIVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAI
PDHTVNIYRENQIGTPNYMAPEALVAMNYTNENDGGNKWKVGKPSDIWSCGCIIYQMIYG
RPPYAGFQGQNRLLAIMNPDVKVIFSEKTANNESIPRSLIDLMKGCLTRDPEKRWSVDQV
LESPFFNPIVVTPFFIKDLIKNAVRYGVDQREVSNEKIEELANDVLGRLTDFKM
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatattcatatcattcacggttgagtattcacaggagagagccgttgcaaaat
ctaggtaccaatattgaacctgatgattcagatgatgaaaaggtatcaggtcctccagta
ctaagcaattttgcatctgcatttctctctgaaggagataagaacacaagcaacataaga
gaagaagaaacaaatgttttcaataactcgaatatgaaactatcacaaactcccaataat
tctattgaaccaaaccaagcggacgatctttcactccattcaacactctttgcaaacact
gtaggcaatcgacaatcaagtttaaccacaatgaacagcaccaataatttcgctctcaac
cacgatactaataaagagcatactgttttcgaggataatttacagaaaattaagtcttta
caacaaactatgaaagaagagcttacatccagatacattgaaaggagaaataagcgattt
ttaacgagtagaagaaataatcttggacccgctaaaagggcttctacatctgcaatctct
gcctccactgaggatagatatcaagaaaatgataaacacagtaataatgagaagtattca
acacaggatgatagtaatattttagcaaagcaggtaggtcgattatcatcaccactgaac
cgtcaaaatcgggcatttcagtcatctaatggcgatgatacaaacatgaaagaaccagtt
gattattcctcaattgaatttggcgagctgactccatttgaatacttaaagaaacatgat
cttcccacttcggaactcccgtatatttcaaggatatattttgagaaacagaagctagaa
aatagacaaaccgtgctcaggaaacgacgcttctcatcgaaggagtcattgtcgctaggc
acaacttcatcattagcaccatattctaactcaaagaataatacaacaaatcaggtttcg
agagacttgtcgttaccaaggaggaagatttcagatacgtcatccaagatttcgaagcaa
atattaaaatcaaatattaacctgtcggaaagtggatcacatggttttccaccagactta
caaagcatacagagacagcatgaatcggcggagaaattgtcacgagcacccttgattgat
ttgaatgtgaataacgtctccccaaaaaggatggataaacttcgggaaactcacaagttt
tctgacagtcgtttaaatgtccaggattttagcaagaaaacagatgttgttgtgtatgaa
aaacaagctcctcggaagaaagttgaaatcgtcgaaccgaaacggtcacattctaaattg
gcaaagcgcaatacgataactgtaaatgatacagaatacgaaaaaattgaactgttagga
agaggggggtcatcaagggtttacaaggtaaaaaactcgcaaaataaggtttttgcttta
aagcgggtttcctttgacgaatttgacgattcgagtgttgatggatttaaaggagagatc
gaactacttgagaaattatccaacgaatctcgagttgtgaaattatttgactatcaaatg
gatagcggtgttctgttcttgatcatggaatgtggggatcacgatctatcacaaatttta
agccagcgaagcgatatgcctttagatatggacttcgtaagataccatgctcgtgaagta
gtgcggtgtatcaaaattgtccatgatgctggaattgttcattctgatttgaagccagca
aactttgtgttcgttaaagggatactaaaaattattgattttggtatcgcaaatgctatt
cctgatcatactgtgaacatttatagggagaatcaaattggaaccccgaattatatggca
cctgaagctctagtagctatgaattatacaaatgaaaatgacggagggaacaaatggaaa
gtaggtaaaccatctgacatatggtcctgtggttgtataatatatcaaatgatatacgga
aggccaccttatgctgggtttcagggacagaacagacttttagccatcatgaaccctgat
gtcaaagtgatattttcggaaaagacagcaaataacgaaagcataccacgatcacttatc
gatttaatgaaaggatgtttaacaagggatccagaaaagcggtggtccgtcgatcaagtc
ttagaaagcccgtttttcaatccaattgttgtgacaccattttttataaaagacctaata
aaaaatgctgttagatacggcgtagaccaaagagaggtatctaatgagaagatcgaagaa
ttggccaatgatgtactgggaagattaactgacttcaagatgtaa

DBGET integrated database retrieval system