KEGG   Naumovozyma castellii: NCAS_0I02680Help
Entry
NCAS_0I02680      CDS       T02233                                 

Gene name
NCAS0I02680
Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ncs  Naumovozyma castellii
Brite
Enzymes [BR:ncs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     NCAS_0I02680 (NCAS0I02680)
Protein kinases [BR:ncs01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   NCAS_0I02680 (NCAS0I02680)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9:498371..500752
Genome map
AA seq 793 aa AA seqDB search
MTTPNDFASPKEMSPRHANSSESLHNNHQLQQGAADQANNNNNIWKSTFMNQQQQQQQQQ
NSFAFTNPWSSNNADSTLSPPQQQQQSYNMDMDEDMLESFKRRKSSLVIPPSRAPAPNPF
QYDQYNQYGPPQSQQQVPSQQQEINYSHQQQQQLYNAHQYGARLGPSMYQDFQRRQSMAA
SHLYPNGNGNNITNYSTRTINKNSSITPNTANPSMMAGPSYIPGGLSNDNSMVSPFRRLS
AYPTTNIHTPATANLQPPYKQLRRTGEEQQQQQQPKPLIIPSMKVCKNRNDLNPITNPTP
KFRRASLNSKTISPLLALTKNLITTYQLCSPDFTYKPSKNPKRVLTKPSEGKFNNGFDNV
NSDYILYVNDVLGSEQNRKYLVLDILGQGTFGQVVKCQNLTTKEILAVKVIKSRSEYLNQ
SITEAKILELINNKIDPENKHHFLRMYDSFIHKNHLCLVFELLSNNLYELLKQNQFHGLS
IQLIRIFTKQMLESLCVLKDSKLIHCDLKPENILLCSPDKPALKIIDFGSSCEETRTVYT
YIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGSSEYNQLTRIVDTLGYP
PNWMIDMGKNSGKFLKRVIDEDDEDDEEGTTKVTKKFELKTLEEFNMDFPDAKEEPGKKY
FKWNKLHDIIKNYRISKSIQNNPRAVEQEMANRECLNHFLEGILNINPLARWTPQQASMH
PFVTQQPFTGEWYPPGSSVNMIHRQNTTNKQERKNDGVLENNFDAKLTVPSKNGEPVARN
KSTSNEFNKLSIE
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgacaacccctaatgactttgcatcaccgaaggaaatgtctccaagacatgcgaatagc
tcagaaagtttgcataataaccaccaacttcaacaaggtgctgctgatcaagcaaacaat
aataataatatatggaaatccacttttatgaaccaacaacagcaacaacaacagcagcag
aacagctttgcatttactaacccctggagtagtaacaatgcagattcaacactatccccc
ccgcagcaacaacaacaaagttataacatggacatggacgaagatatgctcgagtccttc
aagagaagaaaatcaagtttggtaatacctccatccagagcacctgcaccaaatccgttc
caatatgatcaatataatcaatatggacccccacaatctcaacaacaggttccctctcaa
caacaagaaataaactattctcatcagcaacaacaacaattatataatgctcatcagtat
ggtgctaggttgggaccctccatgtaccaggatttccaaagaagacagagcatggctgct
tctcatctttaccctaatggaaatggtaataatataaccaattacagtacaaggactatc
aataagaattcatctattacaccaaatactgcaaacccaagtatgatggctggtccaagt
tacataccgggaggtctttctaatgataattcaatggtatcaccattcagaagattgagt
gcctatccaacaacaaatattcatacaccagcaacggctaacttacaacctccatataag
caactccgaagaactggtgaagagcaacaacagcaacagcaaccaaaaccattaattata
ccatcaatgaaagtttgtaagaatagaaatgatttgaatccaataacgaatccaacacct
aaatttaggcgtgcatcactaaattccaaaaccatctcaccattgttggcattaacaaag
aatttaatcactacttaccaactatgctctcctgattttacatacaaaccttccaaaaat
cctaaacgtgtactgacgaagccatctgaggggaaatttaataatggattcgataatgtt
aacagtgattatatcctttacgttaatgatgtcctgggttcagaacaaaatagaaaatat
ttggtcctagatattttgggtcagggaacgtttggacaagtagttaaatgtcaaaattta
acaactaaggaaatccttgctgttaaagtgattaaatcacggtctgaatacctaaatcaa
agtattacggaagctaaaatattggaattgatcaataataagattgacccggaaaataag
catcattttttaagaatgtacgattccttcattcataagaatcatctttgcttggtattt
gaattactaagtaataacttgtatgaattattgaagcaaaaccaatttcatggactttcc
attcaattaattagaatattcacaaagcaaatgttggaatcgttatgcgttttgaaagat
agtaaattgatccattgtgatttaaaaccagaaaatatattactttgttcaccagataaa
cctgcattaaagattattgatttcggttcatcatgtgaggaaacacgaacagtttatacg
tatattcaatcaagattttaccgtgctccagaaatcatattggggattccgtattctact
agtattgatatgtggtcgttaggttgtatcgtcgctgaattattcttggggatccctatt
ttcccagggtcgtctgaatataaccaattgactagaattgtcgataccttggggtatcca
ccaaattggatgatcgatatgggtaaaaactccggtaaattcttgaaaagagttattgat
gaggatgatgaagatgatgaagaaggaactaccaaggtgacgaagaaatttgaattgaaa
actttagaagaatttaatatggattttcccgacgcaaaggaggaaccagggaaaaaatat
ttcaaatggaataagttacatgacataattaagaattataggatttccaagagcattcaa
aataaccctagagcagtggagcaagaaatggcaaatagagaatgtctgaatcatttcctt
gaaggaatattgaatattaacccactggccaggtggacaccacaacaagcatcaatgcat
ccattcgtcacacaacaaccatttactggtgaatggtatcctcctgggtcaagcgtcaat
atgatacatcgtcaaaatactactaataagcaagagaggaaaaatgatggtgttttggag
aataattttgatgcaaagttgacagtaccttcgaagaatggggagcccgtagcgaggaat
aaaagcacgtcaaacgagtttaataaactaagcattgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system