KEGG   Naumovozyma castellii: NCAS_0J02260Help
Entry
NCAS_0J02260      CDS       T02233                                 

Gene name
NCAS0J02260
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ncs  Naumovozyma castellii
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ncs00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:434013..436301
Genome map
AA seq 762 aa AA seqDB search
MASSKKRSSKSSTPIVDVDDEALKYAKRSTTSFEQVAEKWLLRPPPDSALRYNALLYTVT
LIAFVARFYMIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPPFAKMAIAFIGWLVGYNG
SFKFDEIGSSYQTNPAPYIAYRSFNAMLGTLTVSIMFNTLKELNFKAITCFFGALLVAVD
NAHVTETRLILLDAILLISIAASFYSFVRFYKAQLRAPFSPQWYIWLHLTGLSLSFVIST
KYIGVMTYAAIGTGVIVNLWQLLDLRANLTLRAFFRHFVKRLNGLVFAPFCIYLFWFWVH
FAILSKSGPGDAFMSAEFQETLGDSPMSILSKEVHFYDIITLKHKDTEAFLHSHQAFYPL
RYEDGRISSEGQQVTGFTGTDISNDWEVLPTRELDSHKGVPVVLNEPIRLRHVASNTYLL
AHDVASPFYPTNEEITTVSEEIANGESYQQTVFTFQPLKKGDEGHVVKTKGVQFKIYHPN
TDVVLWTHNDVLLPDWGFEQQEVNGSKNFGDPTNAWSVDEITNLDEDRKKFTPKVVKPMS
FFRKWSELQKSMFEQNNKLSAEHPFASQPQSWPAGLCGVSFWTKSEERKQIFFTANIIGW
WFQVISMSVFIGILLADQISRKRGYFVLGKITREKLYGPLAFLFISWGCHYAPFFLMHRQ
KFLHHYLPAHLIISLFTAGLWEVVFSDCKSIDASRDEEIEGTPYKADPKINSTSLTVFFV
AVSIAIVWFFIYFSPLVYGNVTLRPEEFAKRQWFDIKLNYIK
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggccagttctaagaagcgttcttccaaatcttcgaccccaattgttgacgtcgatgat
gaggcgctaaagtatgccaagcgatccactacttcctttgaacaggttgctgaaaaatgg
cttttgagacctcccccagattcagctctccgttacaatgctctcctttacacagtaaca
ttaattgcctttgtggcaagattctatatgatctggtaccctaaagaagttgtctttgat
gaagttcattttggtaaatttgcatcttattacttagaaaggacctatttctttgatgtc
catccaccttttgcaaaaatggcaattgccttcattggatggttagttggatataatggt
tcttttaaatttgatgagattggatctagttatcaaactaatccagctccatatatcgcc
tatcgttctttcaatgccatgctgggtactttaaccgtctccattatgtttaatactttg
aaagaattaaattttaaggcgattacttgtttttttggtgcactattagttgctgttgat
aatgctcatgttaccgaaactagattgattcttttagacgccattttattgatttccatt
gccgcttcattctacagttttgttcgcttctataaggcccaattgagggcaccattttca
ccacaatggtacatttggttgcatcttactgggttatcattatccttcgttatttctact
aaatatattggagtaatgacctatgctgctattgggacaggtgtaattgttaatttatgg
caattattagatcttcgtgcaaacttaacattaagagctttctttagacattttgtcaaa
agattaaatggattagtttttgccccgttctgtatttatttgttttggttttgggttcat
tttgccatcttaagcaaatcaggtccaggtgatgccttcatgtcagcggaattccaagaa
acattgggtgattctccaatgagtatcttatctaaggaagtacatttctacgacatcatt
actttgaaacataaggatactgaagcctttttgcactctcaccaggctttttatccgtta
cgttatgaagatggtcgtatttcttcagaaggccaacaagttaccgggtttacgggcact
gatatttctaacgactgggaagtccttccaacaagagaattagactcacataagggtgtc
cctgtagtattgaatgaaccaattagactaagacatgttgcatctaatacctatttattg
gcgcatgatgttgcatctccattttatccaactaatgaggaaattactaccgtctcggaa
gaaattgccaatggagaatcatatcaacaaaccgtgttcaccttccaaccattgaagaag
ggagatgaaggtcatgttgtcaagaccaagggtgttcaattcaagatctatcatccaaat
actgatgttgtcttatggacccacaatgatgtattattaccggactgggggtttgaacaa
caagaagttaatggtagtaagaattttggagatccaacaaatgcttggtcagtagacgaa
attacaaatctagatgaagacagaaagaaatttacgcctaaggttgttaagccaatgtca
tttttccgcaaatggtctgaattacaaaaatcaatgtttgaacaaaataataaattatct
gccgagcatcctttcgcttctcaacctcagagttggcctgcaggtctatgtggtgtttct
ttttggacaaagtctgaagaaagaaaacagatattctttactgctaatattattggctgg
tggttccaagtaatttcaatgtctgttttcattggcattctacttgctgatcaaatctca
agaaagcgtggatattttgtcctaggtaagattacaagagagaaattatacggacctcta
gccttcttattcatatcatggggatgccattacgcacctttctttttgatgcatcgtcaa
aagtttttgcatcattatttaccagctcatctaataatttcattatttactgctgggtta
tgggaagttgtatttagtgactgcaaatctattgatgcatccagagatgaagaaattgag
ggaaccccatataaggctgatcctaaaatcaactctacttcattaactgtcttctttgtt
gcagtttcgatagccattgtatggttctttatctatttctcacctttagtgtacggcaac
gttactctaagacctgaagaatttgcgaagagacaatggtttgatattaagttgaactac
ataaaatga

DBGET integrated database retrieval system