KEGG   Nocardia cyriacigeorgica: NOCYR_0276Help
Entry
NOCYR_0276        CDS       T01756                                 

Gene name
recR
Definition
gap repair protein
Orthology
K06187  
recombination protein RecR
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ncy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318472..319080
Genome map
AA seq 202 aa AA seqDB search
MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLQVEPPEIDRLQAVLQKVRDGVRFCAMCG
TVADGELCRICADPRRDRTMICVVEEPKDVQAIERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLARIGNQEDGVDVTEVIIATDPNTEGEATATYLVRMLRDFPGLSVTRLASGLPM
GGDLEFADELTLGRALSGRRAL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgagggcccggtccaggatctgatcgacgagctgggcaagctgccaggcgtcggt
cccaagagcgcgcaacgcatcgccttccacctgttgcaggtggagccgccggaaatcgac
cggctgcaagccgtgctgcagaaggtacgtgacggcgtgcgtttctgcgccatgtgcggc
accgtcgccgacggcgaactgtgccggatctgcgccgacccgcgccgcgaccgcaccatg
atctgcgtggtcgaagagcccaaagacgtccaggccatcgagcgcacccgcgaattccgc
ggccgctaccacgtactcggcggcgcgctcgacccgctcagcggcgtcggcccggaccag
ctgcggattcgggaactgctggcccgcatcggcaatcaggaagacggcgtcgacgtcacc
gaggtgatcatcgcgaccgaccccaacaccgaaggcgaagccaccgccacctacctggtg
cggatgctgcgcgatttccccgggctcagcgtcacccggctggcctccggcctgccgatg
ggcggcgacctggagttcgccgacgagctgacgctgggccgggcgttgtcggggcggcgc
gcgctgtaa

DBGET integrated database retrieval system