KEGG   Nocardia cyriacigeorgica: NOCYR_0288Help
Entry
NOCYR_0288        CDS       T01756                                 

Definition
(GenBank) putative cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00984  Steroid degradation
ncy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    NOCYR_0288
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     NOCYR_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C NAD_binding_8 Pyr_redox_2 FAD_binding_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCF61109
UniProt: H6R8T1
Position
332362..333981
Genome map
AA seq 539 aa AA seqDB search
MDRRAFLEAVGAATLLGVLGSTAGAVTANADPIWDALFREWVPEIFAPLPDPADHSPAIV
VGSGFGASATALRLAQAGISTTVLERGSRWPNDPWREIFTGDDLPDGRGFWHRTSFTGVT
KVPMQFASFGGVLDVTEYPGIDVWRAAAVGGGSIVFSGVMIAPERSLFDHVFGGVVDYGE
LESVYYPRVRQMLRLDAMPADIYQSAPFTHSRAWDDQVRKAGYQPVPNDSIFSWNILRDE
LAGRSRPSATVARSNLGNSNGAKFDLNQNYLRYAEQTGRCGIFPGHRVDAIGQESGGRYS
VTVTKLAPTGDVLRTRTLTCDQLFLGAGSIGSTELLVRAQATGALPNLNEHIGDGWGTNG
DVVLARGASSVAGFGQGVPSASRIFDNSAVPVTLENWYIPGIPFETGALASLGMVLDPTR
TRMGYDRGTDSVGLSWSTRNRDETVAAARAVDRRIAERAGALVEYSALGYDANALFTAHP
LGGAVLGRATDGHGRVHGHPGLYVMDGAAIPGSTATVNPSLTITALAERNIEAIIRAGR
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
gtggataggcgtgccttcctcgaggcggtgggtgcggcgacattgctgggggtcctcgga
tcgacggccggtgcggtcacggcgaatgccgatccgatctgggatgcactgttccgtgaa
tgggtaccggagatcttcgcgccgctacccgatccggccgatcattcgcccgcgatcgtt
gtcggctccggcttcggggcctcggccaccgcattgcgattggcgcaggccgggatctcc
accaccgtcctggaacgcggttcgcgctggcccaacgatccgtggcgggagatcttcacc
ggcgacgatctgcccgacggccgcggtttctggcaccgcacctccttcaccggggtgacc
aaggtgccgatgcagttcgccagtttcggcggggtactcgatgtcaccgaatatccgggg
atcgacgtgtggcgggcggccgcggtgggcggcggctcgatcgtgttcagcggtgtgatg
atcgcgcccgagcgcagcctgttcgaccacgtcttcggcggggtggtggattacggcgag
ctcgagagcgtctactacccgcgggtgcggcagatgctgcggctggacgccatgccggcc
gacatctaccagtcggcgccgttcacccattcgcgcgcctgggacgatcaggtccgcaag
gccggatatcagcccgtgcccaatgattcgatcttcagctggaacatcctgcgcgatgag
ctggccgggcgcagcaggccgtcggcgacggtcgcgcgcagcaatctcggcaactccaac
ggcgccaagttcgatctcaatcagaactatctgcgctacgccgagcagaccggccgctgc
gggatcttcccaggccaccgggtcgacgccatcggccaggagagcggcggacggtattcg
gtcaccgtgacgaaactggccccgaccggcgatgtgctgcgcacccgcaccctgacctgc
gatcagctgttcctcggcgccggctccatcggcagcaccgaactgctggtccgcgcccag
gccaccggcgcgctgcccaacctcaacgaacacatcggcgacggctggggcaccaacggc
gatgtggtgctggcccgcggcgccagctcggtggccggcttcggtcagggtgtgcccagt
gccagccggatcttcgacaattccgcggtcccggtgaccctggagaactggtacatcccg
ggcattccgttcgaaaccggcgcgctggcctcgctcggcatggtgctcgatccgacccgc
acccggatgggctacgaccgcggcacggattcggtggggctgagctggtcgacccgcaat
cgcgacgagacggtggccgccgcgcgcgccgtcgaccggcggatcgccgaacgggcgggc
gcgctggtcgaatacagcgcactcggctacgacgcgaacgccctgttcaccgcgcatccg
ctcggtggtgcggtactgggccgagccaccgatggacacggccgcgtgcacggtcatccc
gggctctacgtcatggacggcgcggcgatccccggcagcaccgcgacggtgaatccctcg
ctcacgattaccgccctggccgaacgcaatatcgaggcgatcatccgcgccggacggtga

DBGET integrated database retrieval system