KEGG   Nocardia cyriacigeorgica: NOCYR_0377Help
Entry
NOCYR_0377        CDS       T01756                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ncy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419615..420625
Genome map
AA seq 336 aa AA seqDB search
MSNATEQAAQTAEPLQYVSDLIDSIADPNPEARTITDPAEAAGLIADETRSRIGAVLERF
GGTPAVLLSGGVDSIYVAAVAVALGGEPVAVTVVTEGGHEETNAAVAAAALGLRHDVIQL
GADDVVRFAREVMGRLGTSELWEVTAGIPLLAARRTFDTIPGLGAILGGSGADAIFGGGR
KLTLPPAAPEARIELDQLIRAESAANFRYQRLVPHFYPALLDEYADRLIHVYQTVRWWQL
AETFAPPALFGTHDGRPFDKLALRLACDAALPADSKHLAWSAKSPIQRSSGLMGALAAAA
RTYAADLPGARTYSDPMTEDAEAVATRLYSAAIEKG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgctaccgagcaggccgcgcagactgccgaaccgctgcaatacgtttcagac
ctcatcgactccatcgcggacccgaatcccgaggcgcgcacgatcaccgatccggccgaa
gccgccgggctgatcgctgacgagacccggtcgcggatcggcgcggtcctcgaacggttc
ggtggtaccccggcggtgctgctgagcggtggggtcgactcgatctacgtggcggctgtg
gctgtcgcgctgggcggcgaaccggtggcggtcaccgtcgtcaccgagggtgggcacgag
gaaacgaacgcggcggtggccgcggcggcgctcggactgcgccatgacgtcatccagctc
ggcgcggatgacgtcgtccggttcgcccgcgaggtgatgggccggctcggcacctcggaa
ctgtgggaggtgacggcggggattccactcctcgcggcccgccgaaccttcgacacgatt
ccgggcctcggcgcgatcctgggcggcagcggcgccgacgccatcttcggcggcggccgg
aaactcaccctcccgcccgccgcacccgaagcgcgcatcgagctcgatcagctgatcagg
gccgaatccgctgcgaacttccgctaccaacgcctcgtcccgcacttctacccagccttg
ctggacgaatacgccgaccgcctgattcacgtctaccaaactgtccgctggtggcagcta
gccgaaaccttcgccccacccgccctcttcggcacccacgacggccgcccgttcgacaag
ctcgccctacgccttgcctgcgacgctgccctgcccgcggattcgaaacacctggcctgg
tccgcgaaatcacccatccagcgctcttccggattgatgggcgcgctcgcagcggccgcc
aggacctacgccgccgacctccccggcgcccgaacctactccgacccgatgaccgaagac
gccgaagccgtcgccacgcggctgtattcggcggccatcgagaagggatag

DBGET integrated database retrieval system