KEGG   Nocardia cyriacigeorgica: NOCYR_0408Help
Entry
NOCYR_0408        CDS       T01756                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NOCYR_0408 (folE)
Enzymes [BR:ncy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NOCYR_0408 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454301..454984
Genome map
AA seq 227 aa AA seqDB search
MSANDHSNGQAPTVPNRAVLDDPGPELSDSELIALHTGKPFDQARAEAAIRELLIAVGED
PDRPGLVDTPARVARAYREMFAGLYLEPDAVLNTTFDEEHQELVLVRDIPLYSTCEHHLV
SFHGVAHVGYIPGTHGRVTGLSKLARLVDLYAKRPQVQERLTSQIADAVMRKLDPRGAIV
VVEAEHLCMAMRGIRKPGASTTTSAVRGLLQTNAASRAEALDLILRK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
ttgtcggccaacgatcacagcaacggccaagctcccaccgtgcccaatcgggcggtgctg
gacgacccggggccggagttgagcgactccgagctcatcgcgctgcacaccggtaagccc
ttcgaccaggcgcgcgccgaggccgcgatccgggaactgctgatcgccgtcggcgaggac
ccggatcggcccggcctggtcgacaccccggcccgcgtcgcccgcgcctatcgggagatg
ttcgccgggctctacctcgagccggacgcggtgctcaacaccaccttcgacgaggagcac
caggagctggtgctggtgcgtgatatcccgctgtactccacctgcgaacaccatctggtt
tccttccacggcgtcgcgcacgtgggctacatccccggcacgcacggccgggtgacgggc
ctgtccaagctggcccggctggtcgatctgtacgccaagcgcccgcaggtgcaggagcgg
ctgaccagtcagatcgccgacgccgtcatgcgcaagctggatccgcgcggcgccatcgtg
gtggtggaggccgagcatctgtgcatggccatgcgcggtatccgcaagccgggcgcgagc
accaccacctcggcggtgcgcggcctgttgcagaccaatgccgcctcgcgcgccgaggcg
ctcgatctgatcctgcgcaagtga

DBGET integrated database retrieval system