KEGG   Nocardia cyriacigeorgica: NOCYR_0408Help
Entry
NOCYR_0408        CDS       T01756                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ncy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
454301..454984
Genome map
AA seq 227 aa AA seqDB search
MSANDHSNGQAPTVPNRAVLDDPGPELSDSELIALHTGKPFDQARAEAAIRELLIAVGED
PDRPGLVDTPARVARAYREMFAGLYLEPDAVLNTTFDEEHQELVLVRDIPLYSTCEHHLV
SFHGVAHVGYIPGTHGRVTGLSKLARLVDLYAKRPQVQERLTSQIADAVMRKLDPRGAIV
VVEAEHLCMAMRGIRKPGASTTTSAVRGLLQTNAASRAEALDLILRK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
ttgtcggccaacgatcacagcaacggccaagctcccaccgtgcccaatcgggcggtgctg
gacgacccggggccggagttgagcgactccgagctcatcgcgctgcacaccggtaagccc
ttcgaccaggcgcgcgccgaggccgcgatccgggaactgctgatcgccgtcggcgaggac
ccggatcggcccggcctggtcgacaccccggcccgcgtcgcccgcgcctatcgggagatg
ttcgccgggctctacctcgagccggacgcggtgctcaacaccaccttcgacgaggagcac
caggagctggtgctggtgcgtgatatcccgctgtactccacctgcgaacaccatctggtt
tccttccacggcgtcgcgcacgtgggctacatccccggcacgcacggccgggtgacgggc
ctgtccaagctggcccggctggtcgatctgtacgccaagcgcccgcaggtgcaggagcgg
ctgaccagtcagatcgccgacgccgtcatgcgcaagctggatccgcgcggcgccatcgtg
gtggtggaggccgagcatctgtgcatggccatgcgcggtatccgcaagccgggcgcgagc
accaccacctcggcggtgcgcggcctgttgcagaccaatgccgcctcgcgcgccgaggcg
ctcgatctgatcctgcgcaagtga

DBGET integrated database retrieval system