KEGG   Nocardia cyriacigeorgica: NOCYR_0409Help
Entry
NOCYR_0409        CDS       T01756                                 

Gene name
folP1
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ncy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455032..455850
Genome map
AA seq 272 aa AA seqDB search
MVMGVVNVTADSFSDGGRYLDPDLAIRHGIELFEAGADIIDVGGESTRPGAIRVDAETES
ARVVPVIRGLVASGVPVSVDTMRAQVAEAAIAAGASVVNDVSGGRADADMVKVIAGADIP
WILMHWRASADYRHTGPADHYDDVIAEVRAELDAQVRAAVAAGVDPARLILDPGLGFAKN
AEHNWALLGALPQFVADGFPVLIGASRKRFLGSLLADDSGPRPPDGRETATATISALAAL
HGAWGVRVHDVRASLDAIAVTDAWQRAAGVVR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatgggcgtggtgaacgtgaccgccgattcgttctccgacggcggccgctacctc
gatcccgacctcgccatccggcacggcatcgaactgttcgaagccggcgccgacatcatc
gacgtcggtggtgaatccacccggcccggcgccatccgggtggatgccgagaccgagtcg
gcccgggtggtcccggtgatccgcggactcgtcgcctcgggtgtgccggtcagcgtcgac
accatgcgcgcccaggtcgccgaggcggccatcgcggcgggcgcttcggtggtcaacgac
gtctccggtggccgcgccgacgccgatatggtcaaggtcatcgcgggcgcggacatcccg
tggatcctcatgcactggcgcgcgagcgccgactaccgccacacaggcccggccgaccac
tatgacgatgtgatcgccgaggtgcgcgcggaactggacgcccaggtgcgggccgcggtc
gcggccggagtggatccggcgcggctgatcctggacccgggtctcggtttcgccaagaac
gccgaacacaattgggccctgctcggcgcgctgccacagttcgttgccgacggtttcccg
gtgttgatcggcgcgtcccgcaagcgtttcctcggctcgctgctggccgacgattccggt
ccgcgtccgcccgacggccgcgagaccgccaccgcgacaatctcggcgctggccgcactg
cacggcgcctggggcgtgcgggtgcacgatgtgcgcgcctcccttgacgccatcgcggtc
accgacgcctggcagcgcgcggcgggagtggtgcggtga

DBGET integrated database retrieval system