KEGG   Nocardia cyriacigeorgica: NOCYR_0411Help
Entry
NOCYR_0411        CDS       T01756                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ncy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
456257..456799
Genome map
AA seq 180 aa AA seqDB search
MSRAVLSIGSNLGDRLGYLRSVIEGFGPRVVAVSPVFSTAPWGGVEQDDFLNSIVVVEDP
DFECIDWLRRGQELERAADRVREVRWGARTLDVDVIWCSDDGLRPCRSEDPELTLPHPQA
HRRAFVLVPWLEVEPDAELEVDGRIRRVRDLLAELDAAERDGVHRTTLTLTRGGADQCSS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgcggtcctgtccatcggctccaatctgggtgaccggctcggctatctgcgc
agcgtgatcgagggtttcggcccgcgggtagtggcggtgtcgccggtgttctcgaccgcg
ccgtggggcggtgtcgaacaggacgatttcttgaattccattgtggtggtggaagatccg
gacttcgagtgcatcgactggctgcgccgcgggcaggaattggagcgggcggccgaccgg
gtgcgtgaagtccgttggggtgcgcgcactctcgacgtcgacgtgatctggtgctccgac
gacggcctgcgcccctgtcgcagtgaggatcccgagctcacgctgccgcatccgcaggcg
catcgccgggcgttcgtgctggtgccgtggctcgaggtggagccggacgccgaactcgag
gtcgacggccgcattcgccgggtgcgcgatctgctggccgaactcgatgccgccgaacgc
gacggcgtgcaccgcaccaccctgactctgacccgcgggggagccgaccagtgcagcagc
tga

DBGET integrated database retrieval system