KEGG   Nocardia cyriacigeorgica: NOCYR_0494Help
Entry
NOCYR_0494        CDS       T01756                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ncy00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ncy00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:ncy00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:ncy00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:ncy00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531846..532754
Genome map
AA seq 302 aa AA seqDB search
MSEGTVTAAIVGSGNISTDLLYKLLRSEHIEPRWMIGIDPDSEGLKRARGLGLETSHEGV
DWLLGQSELPDMVFEATSAYVHRDAAPKYAEKGIRAVDLTPAAVGPAVVPPVNLGANIDA
PNVNMITCGGQATIPIVAAVSRVVPVPYAEIVASVSSVSAGPGTRANIDEFTKTTSRGVQ
TIGGAERGKAIIILNPAEPPMIMRDTIFCAIPDDADTDAIADSIHRMVADIQQYVPGYRL
LNEPQFDEPSVVSGGMAKVSVFVEVEGAGDFLPPYAGNLDIMTAAATRVGEVMAKQIASA
RV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaagggaccgtcaccgccgcgatcgtcgggtccggcaacatcagcaccgatctg
ctgtacaaactgctccgctccgagcacatcgagccgcgctggatgatcggcatcgatccc
gacagcgaaggcctcaagcgcgcccgcgggctggggctggagacctcgcacgagggtgtg
gactggctgctcggccagtccgaactgcccgacatggtcttcgaagccacctcggcgtac
gtgcaccgcgatgcggcgccgaagtacgcggagaaggggattcgcgccgtcgacctcacc
ccggccgccgtcgggcccgccgtggttccgccggtgaacctgggtgccaacatcgatgcg
ccgaacgtcaacatgatcacctgcggtgggcaggcgaccattccgatcgtcgcggccgtc
tcgcgcgtggttccggtgccctacgcggaaatcgtggcgtcggtgtcgtcggtgagtgcc
gggcccggcacgcgcgccaatatcgacgaattcactaagaccaccagccgtggcgtgcag
accatcggcggcgccgaacgcggtaaggccatcatcatcctgaacccggccgaaccgccg
atgatcatgcgcgacaccatcttctgcgccatccccgacgacgccgacaccgacgcgatc
gccgactccatccaccggatggtcgccgacatccagcagtacgtgcccggttaccggctg
ctcaacgagccccagttcgacgagccgtcggtggtgtccggcggcatggcgaaggtctcg
gtcttcgtcgaggtcgaaggcgcgggcgacttcctgccgccctacgcgggcaacctcgac
atcatgaccgccgccgccaccagggtcggcgaggtcatggccaagcagatcgcctcggca
cgggtgtaa

DBGET integrated database retrieval system