KEGG   Nocardia cyriacigeorgica: NOCYR_0494Help
Entry
NOCYR_0494        CDS       T01756                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NOCYR_0494 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NOCYR_0494 (mhpF)
   00650 Butanoate metabolism
    NOCYR_0494 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    NOCYR_0494 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOCYR_0494 (mhpF)
   00622 Xylene degradation
    NOCYR_0494 (mhpF)
   00621 Dioxin degradation
    NOCYR_0494 (mhpF)
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     NOCYR_0494 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531846..532754
Genome map
AA seq 302 aa AA seqDB search
MSEGTVTAAIVGSGNISTDLLYKLLRSEHIEPRWMIGIDPDSEGLKRARGLGLETSHEGV
DWLLGQSELPDMVFEATSAYVHRDAAPKYAEKGIRAVDLTPAAVGPAVVPPVNLGANIDA
PNVNMITCGGQATIPIVAAVSRVVPVPYAEIVASVSSVSAGPGTRANIDEFTKTTSRGVQ
TIGGAERGKAIIILNPAEPPMIMRDTIFCAIPDDADTDAIADSIHRMVADIQQYVPGYRL
LNEPQFDEPSVVSGGMAKVSVFVEVEGAGDFLPPYAGNLDIMTAAATRVGEVMAKQIASA
RV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaagggaccgtcaccgccgcgatcgtcgggtccggcaacatcagcaccgatctg
ctgtacaaactgctccgctccgagcacatcgagccgcgctggatgatcggcatcgatccc
gacagcgaaggcctcaagcgcgcccgcgggctggggctggagacctcgcacgagggtgtg
gactggctgctcggccagtccgaactgcccgacatggtcttcgaagccacctcggcgtac
gtgcaccgcgatgcggcgccgaagtacgcggagaaggggattcgcgccgtcgacctcacc
ccggccgccgtcgggcccgccgtggttccgccggtgaacctgggtgccaacatcgatgcg
ccgaacgtcaacatgatcacctgcggtgggcaggcgaccattccgatcgtcgcggccgtc
tcgcgcgtggttccggtgccctacgcggaaatcgtggcgtcggtgtcgtcggtgagtgcc
gggcccggcacgcgcgccaatatcgacgaattcactaagaccaccagccgtggcgtgcag
accatcggcggcgccgaacgcggtaaggccatcatcatcctgaacccggccgaaccgccg
atgatcatgcgcgacaccatcttctgcgccatccccgacgacgccgacaccgacgcgatc
gccgactccatccaccggatggtcgccgacatccagcagtacgtgcccggttaccggctg
ctcaacgagccccagttcgacgagccgtcggtggtgtccggcggcatggcgaaggtctcg
gtcttcgtcgaggtcgaaggcgcgggcgacttcctgccgccctacgcgggcaacctcgac
atcatgaccgccgccgccaccagggtcggcgaggtcatggccaagcagatcgcctcggca
cgggtgtaa

DBGET integrated database retrieval system