KEGG   Nocardia cyriacigeorgica: NOCYR_0512Help
Entry
NOCYR_0512        CDS       T01756                                 

Gene name
echA
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NOCYR_0512 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NOCYR_0512 (echA)
   00650 Butanoate metabolism
    NOCYR_0512 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    NOCYR_0512 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOCYR_0512 (echA)
   00310 Lysine degradation
    NOCYR_0512 (echA)
   00360 Phenylalanine metabolism
    NOCYR_0512 (echA)
   00380 Tryptophan metabolism
    NOCYR_0512 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NOCYR_0512 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NOCYR_0512 (echA)
   00281 Geraniol degradation
    NOCYR_0512 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOCYR_0512 (echA)
   00627 Aminobenzoate degradation
    NOCYR_0512 (echA)
   00930 Caprolactam degradation
    NOCYR_0512 (echA)
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NOCYR_0512 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(547843..548730)
Genome map
AA seq 295 aa AA seqDB search
MPFEPDVVTYERRGAVAVITMNRPDYRNAQNSVMTYALDAAFERAVEDPEVGVIVLAGNG
KHFSAGHDIGTPGRDHHVRYPNKAALWWDHVDRAGGDQRFARETEVYLGMCRRWREIPKP
TIAMVQGACIAGGLMLAWVCDLIVASEDAFFSDPVVRMGIPGVEYFAHPWVLGPRVAKEF
LFTGDRFSAAQAKEWGMVNRVVPRDQLEAETFALADKIATMPQFGLALTKKAVNQAEDLM
GMRSGMDSVFGLHHFAHAHNAEVGADSLGGMNATTMKATASTASADVDATQNGTK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgccgttcgaaccggatgtggtgacctatgagcgccgcggggcggtcgcggtgatcacc
atgaaccggccggactaccgcaatgcccagaactcggtgatgacctacgccctggacgcc
gccttcgagcgggcggtggaagatcccgaggtcggcgtcatcgtgctggccggtaacggc
aagcatttcagcgccgggcacgatatcggcacgccgggccgcgaccatcacgtgcgttat
ccgaacaaggccgccctgtggtgggaccatgtggaccgcgccggcggcgatcagcgcttc
gcccgcgagaccgaggtctatctgggcatgtgccggcgctggcgggagatccccaagccg
accatcgcgatggtgcagggcgcctgcatcgcgggcgggctgatgctggcgtgggtgtgc
gatctgatcgtcgcctccgaggacgccttcttctccgatcccgttgtccggatgggcatt
ccgggcgtggagtacttcgcccacccgtgggtgctcggtccgcgcgtggccaaggagttc
ctgttcaccggcgaccggttcagcgccgctcaggccaaggaatggggcatggtcaaccgg
gtggtgccgcgcgatcagctcgaggccgagaccttcgcgctggccgacaagatcgccacc
atgccgcagttcgggctcgcgctcaccaagaaggcggtcaatcaggccgaggatctgatg
ggcatgcggtcgggcatggattcggtgttcggcctgcaccatttcgcgcacgcccacaat
gccgaggtcggcgccgattccctgggcggcatgaacgccacaacgatgaaagccacggcg
agtacggcgtccgccgacgtcgacgccacgcagaacgggacgaaataa

DBGET integrated database retrieval system