KEGG   Nocardia cyriacigeorgica: NOCYR_1016Help
Entry
NOCYR_1016        CDS       T01756                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    NOCYR_1016 (deoA)
Enzymes [BR:ncy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     NOCYR_1016 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1142431..1143717
Genome map
AA seq 428 aa AA seqDB search
MTALDAVSIITTKRDGGQLSDAQIDWVIDAFTRGEVADEQMSALAMAVLLRGMTRRETAR
WTAAMIASGQRMDFTDLPRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHT
GGTLDKLESIPGWQADLTVPRMREILADPAAGAVVCAAGADLAPADKRLYALRDVTGTVE
SIPLIASSIMSKKIAEGTGGLVLDVKVGAGAFMKSAEDARELATTMVELGQDAGVRTVAL
LTGMDTPLGRTAGNALEVAEAVEVLAGGGPADVVELTLALAREMVALAGIDADPEQALAD
GRAMDHWKAMIRAQGGDPDAPLPRARHTEVVRADTDGVLTRLDAMGVGLAAWRLGAGRAR
QGAPVQAGAGVQIHARPGDTVRAGSPLFTLHTDTPESFPGALAAVTGAVTIGAEQGAISA
PLILDRIG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcactggacgcggtatccatcatcaccaccaaacgcgacggcgggcagctgtcg
gatgcgcagatcgactgggtgatcgacgccttcacccggggcgaggtggccgatgagcag
atgtcggcgctggccatggcggtcctgctgcgcggcatgacccggcgggagacggcacgc
tggaccgcggcgatgatcgcctccgggcagcggatggacttcaccgacctgccgcgcccg
accgtcgacaaacattccaccggcggcgtcggcgacaagatcaccctgccgctggcaccg
ctggtcgcggcctgcggtgccgcggtgccgcagctgtccgggcgcgggctcggccacacc
ggcggcacgctcgacaagctcgaatccatccccggctggcaggccgatctcaccgtgccc
cggatgcgcgagatcctcgccgacccggctgcgggcgcggtggtgtgcgcggccggcgcg
gacctggcgcccgcggacaaacgcctctacgcactgcgcgacgtcaccggaaccgtcgaa
tccattccgctgatcgcgagctcgatcatgagcaagaagatcgcggaaggcaccggcggg
ctggtgctggacgtgaaggtcggcgcgggcgcgttcatgaagagcgccgaggacgcgcgg
gagctggcgaccaccatggtcgagctggggcaggacgccggcgtgcgtaccgtcgcgctg
ctgaccgggatggacaccccgctcggccgcaccgcgggcaatgccctcgaagtggccgag
gccgtggaggtgctggccggtggcggtcccgccgatgtcgtggagctgactctcgcactc
gctcgggagatggtcgcgctcgccgggatcgacgccgaccccgagcaagccctggccgac
ggccgcgccatggaccactggaaggcgatgatccgcgcccagggcggcgatccggacgcg
ccgctgccgcgggccaggcacaccgaggtcgtgcgtgcggataccgacggcgtgctgacc
cgcctcgatgcgatgggtgtcggcctcgccgcttggcgtctgggtgcgggccgcgcgcgg
caaggcgcgccagtgcaggcgggggcgggcgtgcagatccatgctcgccccggcgatacg
gtgcgcgccgggagtcccttgttcaccttgcatacggatacgcccgagagtttccccggg
gcgctcgcagcggtcaccggggcggtgacgatcggcgccgagcagggcgcgatctcggcg
ccgttgattctcgatcgcattgggtga

DBGET integrated database retrieval system