KEGG   Nocardia cyriacigeorgica: NOCYR_1048Help
Entry
NOCYR_1048        CDS       T01756                                 

Gene name
lat
Definition
L-lysine aminotransferase
Orthology
K03918  
L-lysine 6-transaminase [EC:2.6.1.36]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Metabolic pathways
Brite
Enzymes [BR:ncy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.36  L-lysine 6-transaminase
     NOCYR_1048 (lat)
Amino acid related enzymes [BR:ncy01007]
 Aminotransferase (transaminase)
  Class III
   NOCYR_1048 (lat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1177751..1179100
Genome map
AA seq 449 aa AA seqDB search
MTIELERTRSDGDEESVTTASRVHEILSASILADGFELVLDLRRSQGRHLVDERDGTVYL
DMFGFFASNALGMNHPALAGDEAFVAELATAALNKPSNSDIYTVAMARFVQTFVRVLGDP
RLPHLFFIDGGGLAVENALKVAFDWKSRHNESHGRSPRLGTQVMHLTGAFHGRTGYTLSL
TNTDPVKTARFPVFEWPRIDAPYLGEGRDIAAAEQLALDQAARAFAENPHDIACFIAEPI
QGEGGDRHLRPEFLAAMQQLCHDNDALFVLDEVQTGVGMTGTTWAYQQLGLTPDVVAFGK
KTQVCGVMAGGRVDEVSDNVFAVSSRLNSTWGGNLTDMVRTRRILEVIERDGLVDRARLL
GVHLLDGLTELAQRHPTVTEPRGRGLMCAITLPDTRFRDDVLTQLREREHVLLLGTGERG
IRFRPPLTVTTEELDAAVTALDRVLTDLP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgaactggagcgcacccgctcggatggtgacgaggaatcggtcaccaccgca
tcccgagtacacgagatcttgtcggcgagcatcctcgccgatggcttcgagctggttctg
gacctgcgccgatcgcagggccgccacctcgtcgacgaacgcgacggcaccgtctacctg
gacatgttcggcttcttcgcctccaacgccctcggcatgaatcatccggcgctcgccggt
gacgaggcgttcgtcgcggaattggccaccgccgcactcaacaagcccagcaactccgac
atctacaccgtcgccatggcccgcttcgtgcagaccttcgtgcgggtgctcggcgatccc
cggctgccgcacctgttcttcatcgacggcggcggcctcgccgtggagaacgcgctcaag
gtggccttcgactggaagagcaggcacaacgaaagccacggccggtcaccgcgtctgggc
acccaggtgatgcacctgaccggcgccttccacggccgcaccggctacacgctgtcgctg
accaacaccgatccggtcaaaaccgcccgcttcccggtcttcgagtggccgcgcatcgac
gcgccgtacctgggtgagggacgcgatatcgcggccgcggaacagctggcactcgaccag
gcggcccgcgccttcgccgagaacccgcacgatatcgcgtgtttcatcgccgaaccgatc
cagggcgagggcggcgaccgccatctgcgcccggaattcctcgccgccatgcagcagctg
tgccacgacaacgacgcgctgttcgtgctcgacgaggtgcagaccggcgtcgggatgacc
ggaacgacctgggcctaccagcaattggggttgacaccggacgtggtggccttcggcaag
aagacccaggtctgcggcgtgatggcgggcgggcgcgtcgacgaggtgagcgacaacgtg
ttcgcggtgagttcccggttgaattcgacctggggcggcaatctcaccgatatggtgcgc
actcgacgcatcctcgaggtgatcgaacgcgatggcctcgtcgaccgggcccggctgctc
ggggtgcatctgctggacgggctcaccgagctggcgcagcggcatcccaccgtcaccgaa
ccgcgcggccgtgggctgatgtgcgcgatcaccctgcccgacacccgcttccgcgacgac
gtgctcacccagctgcgcgaacgcgagcatgtgctgctgctcggcaccggcgagcgaggc
atccgattccgtccgccgctgacggtcaccaccgaagaactcgacgccgcggtgaccgcg
ctggaccgggtgctcaccgatctgccctga

DBGET integrated database retrieval system