KEGG   Nocardia cyriacigeorgica: NOCYR_1109Help
Entry
NOCYR_1109        CDS       T01756                                 

Definition
enoyl-CoA hydratase (modular protein)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NOCYR_1109
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NOCYR_1109
   00650 Butanoate metabolism
    NOCYR_1109
  Lipid metabolism
   00071 Fatty acid degradation
    NOCYR_1109
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOCYR_1109
   00310 Lysine degradation
    NOCYR_1109
   00360 Phenylalanine metabolism
    NOCYR_1109
   00380 Tryptophan metabolism
    NOCYR_1109
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NOCYR_1109
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NOCYR_1109
   00281 Geraniol degradation
    NOCYR_1109
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOCYR_1109
   00627 Aminobenzoate degradation
    NOCYR_1109
   00930 Caprolactam degradation
    NOCYR_1109
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NOCYR_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235898..1236989
Genome map
AA seq 363 aa AA seqDB search
MSEPEVLIETRDGLGVITLNRPKAINALNHPMVRTITDALRAWAEDPQIRTVVLTGAGER
GLCAGGDIVAIHDDAKRAQQDPDASATGAESASGQFWRDEYILNALIGRYPKPYVAVMDG
IVMGGGVGLSGHAGHRIVTERSMIGMPEVGIGFVPDVGGTYLLARTPGELGTHVALTTAR
MRAGDAIAAGFADYYIPSEHIPALLDTLRSETADIAIAKFATAAPESELLAQRSWIDACY
SADTVEEIVDRLRANGPEAQAAATELLSKSPVSLKVTLRSLRSARRAQSLETVLNEEYRV
SIATLGSHDLVEGIRAQVIDKDRNPQWSPATLDAVTDEQVATYFTELGGHELGLTAPSPE
GQQ
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacccgaagtcctgatcgagacccgcgacgggctcggcgtcatcacgctgaac
cggcccaaggcgatcaacgcgctcaatcacccgatggtgcgcaccatcaccgacgcgctg
cgcgcctgggccgaggacccgcagatccgcaccgtggtgctcaccggtgcgggcgagcgc
ggcctgtgcgcgggcggcgatatcgtcgccatccacgacgacgccaagcgcgcccagcag
gatccggacgcctcggccaccggcgcggaatccgcctcgggccagttctggcgcgacgag
tacatcctcaacgcgctgatcgggcgctaccccaagccgtatgtggcggtgatggacggc
atcgtcatgggcggcggtgtgggtttgtccggacatgccgggcaccggatcgtcaccgag
cggtccatgatcggcatgcccgaggtcggtatcgggttcgtgcccgatgtcggcggcacc
tatctgctggcccgcacccccggcgagctcggcacccatgtggcgctcaccaccgcccgg
atgcgcgccggtgacgccatcgccgccggtttcgccgactattacattccctccgagcac
attccggcgctgctggacacgctgcgcagcgagaccgccgatatcgccatcgccaaattc
gccaccgccgcaccggaatcggagctgctggcccagcggtcctggatcgacgcctgctac
agcgccgatacggtcgaagagatcgtggaccgcctgcgcgccaacggccccgaggcacag
gcagcggccaccgaactgctgtcgaaatcgccggtgtcgctgaaggtcacgctgcgttcg
ctgcgttccgcacggcgcgcgcagtcgctggagacggtgctgaacgaggaataccgcgtc
tcgatcgccacgctcggatcccacgacctggtcgagggcattcgcgcgcaggtcatcgac
aaggatcgcaacccgcaatggtcgccggccactctggacgcggtgaccgacgagcaggtc
gcgacctatttcaccgaattgggtggccacgaactgggtttgaccgccccgagcccggag
ggacagcagtga

DBGET integrated database retrieval system