KEGG   Nocardia cyriacigeorgica: NOCYR_1121Help
Entry
NOCYR_1121        CDS       T01756                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00260  Glycine, serine and threonine metabolism
ncy00750  Vitamin B6 metabolism
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01230  Biosynthesis of amino acids
Module
ncy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NOCYR_1121 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NOCYR_1121 (thrC)
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NOCYR_1121 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CCF61929
UniProt: H6R3H2
Position
1249730..1250791
Genome map
AA seq 353 aa AA seqDB search
MHSRWPGLITAYRDRLAVGADWEPVTLFEGGTPLVPATHLSELTGCEVYLKVEGLNPTGS
FKDRGMTMAITDAKYRGQKAVLCASTGNTSASAAAYATRAGMSCAVLIPEGKIAMGKLAQ
AVMLGAKVIQVQGNFDDCLELARKVTSEFPEIGLVNSVNPARIEGQKTASFEICDVLGKA
PDVHVLPVGNAGNITAYWRGYREYQADGVTSSLPRMLGVQAAGAAPLVNGAPVKDPETIA
TAIRIGAPASWNSAVEAKEQSGGAFRAATDEEILAAYRLVAATEGVFVEPASAASVAGLL
AARKEGWLDSGLTVVCTVTGNGLKDPDTALLGMPQVQAIPVDPVAVAAELELA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcactcccggtggccgggcctgatcacggcctaccgcgatcggctcgccgtcggtgcc
gactgggagccggtcaccctcttcgagggcggcaccccgctggtgcccgcgacgcatctg
tccgagctgaccggttgcgaggtctacctcaaggtcgagggcctgaacccgaccggttcg
ttcaaggaccgcggtatgaccatggccatcaccgatgccaagtaccgcggccagaaggcc
gtgctgtgcgcctccaccggtaacacctcggcctcggcggcggcctacgccacccgcgcc
gggatgagctgcgcggtgctgatccccgagggcaagatcgcgatgggcaagctggcccag
gccgtcatgctcggcgcgaaggtcatccaggtgcagggcaacttcgacgactgtctggag
ctggcccgcaaggtgacctccgagttcccggagatcgggctggtcaactcggtgaacccg
gcccgcatcgaaggccagaagacggcctcgttcgagatctgcgatgtgctgggcaaggcg
ccggatgtgcacgtgcttccggtcggtaatgccggcaacatcaccgcctactggcgcggt
taccgcgaataccaggccgacggcgtcaccagctcgctgccgcgcatgctcggcgtgcag
gccgccggtgcggccccgctggtcaacggtgccccggtgaaggacccggagaccatcgcc
accgccatccggatcggcgccccggcctcgtggaacagcgcggtcgaggccaaggagcag
tccggtggcgccttccgcgcggccaccgacgaggagatcctggcggcctaccggctggtc
gcagcgaccgagggcgtgttcgtcgaacccgcgtcggcggccagcgtcgccggtctgctc
gccgcccgcaaggagggctggctcgattccgggctcaccgtggtgtgcaccgttaccggc
aacgggctcaaggaccccgataccgcgctgctgggaatgccgcaggtccaggcgattccg
gtggacccggtcgcggtcgccgccgaactcgagctggcctga

DBGET integrated database retrieval system