KEGG   Nocardia cyriacigeorgica: NOCYR_1140Help
Entry
NOCYR_1140        CDS       T01756                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NOCYR_1140 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NOCYR_1140 (murA)
Enzymes [BR:ncy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     NOCYR_1140 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1268568..1269827
Genome map
AA seq 419 aa AA seqDB search
MERFLVTGGNRLVGEVAVGGAKNSVLKLMAAALLAEGTTTITNCPDILDVPLMADVLRGL
GCDVTIEGSVVTIDTPAEPKYHADFPAVTQFRASVCVLGPLMARCKRAVVALPGGDAIGS
RPLDMHQAGLRLLGATSEIEHGCVVARADELQGARIRLDFPSVGATENILMAAVLAEGET
VIDNAAREPDIVDLCNMLVQMGARISGAGTSVLTIEGVERLSPTTHRVIGDRIVAATWGI
AAAMTMGDVRVTGVNPKHLSLVLDKLRSAGARISFEPEGFRVVQPERPRAVNFSTLPFPG
FPTDLQPMAIGLAAISDGTSMITENIFEARFRFVEEMIRLGADARTDGHHAVVRGIPRLS
SAPVWSSDIRAGAGLVLAGLVADGTTEVHDVFHIDRGYPNFVEQLQALGGQVVRVGAAE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttttctggtaactggcggcaatcggctcgtcggtgaggtcgcggtcgggggc
gccaagaacagcgtcctcaagttgatggccgcggccctgctggccgagggcaccacaacc
atcaccaactgccccgacatcctcgacgtcccgttgatggcggacgtgctgcgtggcctg
ggctgcgatgtgacgatcgaggggtcggtcgtcaccatcgacacccccgccgaaccgaag
tatcacgccgatttcccggccgtcacccagttccgtgcctcggtctgtgtgctcgggccg
ctgatggcgcggtgcaagcgcgcggtcgtcgcgctgcccggcggcgatgcgatcggctcc
cggccgctggatatgcatcaggccggtctgcgcctgctcggcgctaccagcgagatcgag
cacggatgcgtggtggcccgcgccgacgagctccagggcgcccggatccggctcgacttc
ccgtccgtcggtgccaccgagaacatcctcatggccgcggtgctggccgagggggagacc
gtcatcgacaatgccgcgcgcgagccggacatcgtcgacctgtgcaacatgctggtgcag
atgggtgcccggatcagcggcgcgggcacctcggtgctcaccatcgagggcgtcgagcgg
ctctcgcccaccacccaccgggtgatcggcgaccgcatcgtcgcggccacctggggcatc
gccgcggcgatgaccatgggcgatgtgcgcgtcaccggggtgaacccgaagcatctgtcg
ctggtgctggacaaactgcggtcggccggcgcccggatctccttcgaacccgagggtttc
cgtgtcgtgcagccggagcgtccgcgtgcggtgaacttctccaccctgccgttccccggt
ttccccaccgacctgcagcccatggcgatcggcctcgcggccatctccgacggcacctcg
atgatcaccgagaacatcttcgaagcgcgattccgcttcgtggaggagatgatccggctg
ggcgccgacgcccgcaccgacggccatcacgcggtcgtccgcggaatcccgcggttgtcc
agtgcgccggtgtggtcctccgacatccgcgccggcgccggactggtgctggccggtctg
gtcgccgacggtacgaccgaggtgcacgacgtcttccatatcgaccgcggttatccgaat
ttcgtcgagcagctccaggcgctgggcggtcaagtggtgcgggtcggcgcagcggaatga

DBGET integrated database retrieval system