KEGG   Nocardia cyriacigeorgica: NOCYR_1439Help
Entry
NOCYR_1439        CDS       T01756                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NOCYR_1439
Enzymes [BR:ncy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NOCYR_1439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1606440..1607309)
Genome map
AA seq 289 aa AA seqDB search
MTDGQAPVIAVLGSINMDLVTTTARRPEPGETVLGSGFAMVPGGKGANQAIAAGRAGGRV
EFIGAVGDDVFADELRAVLRQSGVGTARLRTVDGPSGIAAIVVDAAGENSIIVVGGANAT
LTELSDDDLAVIAGADILLCQLEIPVQTVAAAARHAQANGTVVVLNPSPARPLPPELWAD
VDVAVVNSGEFAELGAALDAVPHLVVTLGADGARYRGTDGRELRVPGLRVQVVDTTGAGD
TFTGALAVAWQRGPAEALRWACAAGALATTRLGASASIPAREEIEAALD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacggacaggcacccgtgatcgcggtgctgggcagcatcaatatggatctggtc
accactaccgcgcggcggccggagccgggcgagacggtgctcgggagcgggttcgcgatg
gtgcccgggggtaagggagcgaatcaggcgatcgcggcggggcgggccggtgggcgggtg
gagttcatcggcgcggtcggtgacgatgtgttcgccgatgagcttcgggcggtgctgcgt
cagtcgggcgtggggaccgcgcggctgcggacggtcgatggaccgagtgggatcgcggcg
atcgtggtggacgctgccggggaaaacagcatcatcgtggtgggtggggccaatgccacg
ctcaccgaactctccgacgacgaccttgccgtcatcgccggcgcggatatcttgctgtgc
caattggagattccggtgcagacggtggcagcggccgctcggcatgcgcaagcgaacggg
accgtcgtcgtgctcaacccgtcaccggcgcggccactgccgcccgagctgtgggccgat
gtcgacgtcgcggtggtcaactcgggcgaattcgccgaactcggcgccgccctcgacgcg
gtgccgcatctggtggtgaccctcggcgcggacggtgcgcgttaccgcggaacggacggc
cgggaactgcgtgtgccagggctgcgtgtgcaggtcgtggacacgacaggcgcgggcgac
accttcaccggcgcgctcgcggtggcctggcagcgcggtccggccgaggccctgcgctgg
gcgtgtgcggcgggcgcgctcgccaccacccggctgggtgccagcgcctcgattccggcg
cgcgaggagatcgaggcagcgctcgactga

DBGET integrated database retrieval system