KEGG   Nocardia cyriacigeorgica: NOCYR_1805Help
Entry
NOCYR_1805        CDS       T01756                                 

Gene name
dlaT
Definition
dihydrolipoyl acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ncy01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ncy00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ncy00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2020221..2022020)
Genome map
AA seq 599 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPTAGVLSKIV
AQEDDVVEVGGELGIISEAGEDAAPAESPEPAAAPEPAPEPEPAAQAPAPAEQAPAEQAP
AEPAPAAQASGDGASGTPVNMPELGESVTEGTVTRWLKAVGDEVAVDEPLLEVSTDKVDT
EIPSPVAGTLLEITAQEDDTVSVGGQLGIIGSGSPAAAPAPAPAPAPAPEPKPEPKPEPA
PAAAAPAPAPAPAPARAPEPKPAPKPAPAPAAQAPAPAAPAPAANGATPYVTPLVRKLAE
ENGVDLSTLTGSGVGGRIRKQDVLAAAEAKKAPAPAAAAPAKAAPAAKAPAAAKPELAHL
RGTTQKANRIRQITATKTRESLQTTAQLTQVHEADVTKIAALRAQAKAAFKEREGVNLTF
LPFFAKAVVEALGVHPNVNASYDEGTKEITYHAAVHLGIAVDTEQGLLSPVIHNASDLSL
AGLARAIADIADRARNGGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIV
KRPVVVTDETGNESIGVRSMCYLPLTYDHRLIDGADAGRFLTTIRHRLEEAAFEADLGL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgctcttggtgagagcgtcaccgagggaacggtgacc
aggtggctgaagcaggaaggagacacggtcgaggtcgacgagccgctgctcgaagtctcc
accgataaggtcgacaccgagatcccgtcccccacggcgggtgtgctgtcgaagatcgtc
gcccaggaagacgacgtggtcgaggtcggtggcgagctcggcatcatcagcgaggccggc
gaggacgccgcgcccgccgagtcccccgaacccgccgcggccccggaaccggcccccgaa
cccgagcccgccgcgcaggccccggcgccggccgaacaggctcccgccgagcaggccccg
gccgaaccggcaccggccgcgcaggcttccggcgacggcgcttccggcaccccggtgaac
atgccggagctgggcgaatccgtcaccgagggcaccgtcacccgctggctcaaggccgtc
ggtgacgaggtcgccgtcgacgagccgctgctcgaggtctccaccgacaaggtcgacacc
gagatcccgtccccggtcgcgggcacgctgctggagatcaccgcgcaggaagacgacacc
gtctctgtcggcggtcagctcggcatcatcggcagtgggtcgcccgccgccgctccggcg
cctgcgcccgctccggccccggctcccgaaccgaagcccgagcccaagccggagcccgct
ccggctgctgccgccccggcccccgcgcctgctccggctccggctcgggctccggagccc
aagccggcccccaagcccgccccggctcccgcggcgcaggctcccgctccggccgctccc
gcgcccgccgcgaacggcgcgacgccgtacgtcaccccgctggtgcgcaagctggccgag
gagaacggcgtcgacctgtccaccctcaccggttccggtgtcggtggccgcatccgcaag
caggatgtgctggccgccgccgaggcgaagaaggccccggctccggccgccgccgcgccc
gccaaggccgctccggccgcgaaggcgcccgccgccgccaagccggaactggcgcatctg
cgtggcaccacccagaaggccaaccgcatccgccagatcaccgcgaccaagacgcgggaa
tcgctgcagaccaccgcgcagctgacccaggtccacgaggccgacgtcaccaagatcgcg
gccctgcgggcacaggccaaggccgcgttcaaggagcgcgagggcgtcaacctgacgttc
ctgccgttcttcgccaaggccgtggtcgaggcgctgggtgtgcaccccaacgtcaacgcc
agctacgacgagggcaccaaggagatcacctaccacgccgcggtgcacctgggcatcgcc
gtggacaccgagcagggcctgctgtccccggtgatccacaacgccagcgacctgtcgctg
gccgggctcgcgcgcgccatcgccgatatcgccgatcgcgcccgcaacggtggcctcaag
cccgacgagctggccggtggcaccttcaccatcaccaatatcggcagccagggcgcgctg
ttcgacaccccgatcctggttccgccgcaggcggccatgctcggtacgggtgcgatcgtc
aagcgtccggtcgtggtcaccgacgagaccggcaacgagtcgatcggtgtgcggtcgatg
tgctacctgccgctgacctacgatcaccgcctgatcgacggcgccgacgcgggtcgtttc
ctcaccacgatccggcatcggctcgaagaggcggcgttcgaggctgacctcggcctgtaa

DBGET integrated database retrieval system