KEGG   Nocardia cyriacigeorgica: NOCYR_1805Help
Entry
NOCYR_1805        CDS       T01756                                 

Gene name
dlaT
Definition
(RefSeq) dihydrolipoyl acetyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NOCYR_1805 (dlaT)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NOCYR_1805 (dlaT)
  Amino acid metabolism
   00310 Lysine degradation
    NOCYR_1805 (dlaT)
Enzymes [BR:ncy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NOCYR_1805 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2020221..2022020)
Genome map
AA seq 599 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPTAGVLSKIV
AQEDDVVEVGGELGIISEAGEDAAPAESPEPAAAPEPAPEPEPAAQAPAPAEQAPAEQAP
AEPAPAAQASGDGASGTPVNMPELGESVTEGTVTRWLKAVGDEVAVDEPLLEVSTDKVDT
EIPSPVAGTLLEITAQEDDTVSVGGQLGIIGSGSPAAAPAPAPAPAPAPEPKPEPKPEPA
PAAAAPAPAPAPAPARAPEPKPAPKPAPAPAAQAPAPAAPAPAANGATPYVTPLVRKLAE
ENGVDLSTLTGSGVGGRIRKQDVLAAAEAKKAPAPAAAAPAKAAPAAKAPAAAKPELAHL
RGTTQKANRIRQITATKTRESLQTTAQLTQVHEADVTKIAALRAQAKAAFKEREGVNLTF
LPFFAKAVVEALGVHPNVNASYDEGTKEITYHAAVHLGIAVDTEQGLLSPVIHNASDLSL
AGLARAIADIADRARNGGLKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIV
KRPVVVTDETGNESIGVRSMCYLPLTYDHRLIDGADAGRFLTTIRHRLEEAAFEADLGL
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgcccgctcttggtgagagcgtcaccgagggaacggtgacc
aggtggctgaagcaggaaggagacacggtcgaggtcgacgagccgctgctcgaagtctcc
accgataaggtcgacaccgagatcccgtcccccacggcgggtgtgctgtcgaagatcgtc
gcccaggaagacgacgtggtcgaggtcggtggcgagctcggcatcatcagcgaggccggc
gaggacgccgcgcccgccgagtcccccgaacccgccgcggccccggaaccggcccccgaa
cccgagcccgccgcgcaggccccggcgccggccgaacaggctcccgccgagcaggccccg
gccgaaccggcaccggccgcgcaggcttccggcgacggcgcttccggcaccccggtgaac
atgccggagctgggcgaatccgtcaccgagggcaccgtcacccgctggctcaaggccgtc
ggtgacgaggtcgccgtcgacgagccgctgctcgaggtctccaccgacaaggtcgacacc
gagatcccgtccccggtcgcgggcacgctgctggagatcaccgcgcaggaagacgacacc
gtctctgtcggcggtcagctcggcatcatcggcagtgggtcgcccgccgccgctccggcg
cctgcgcccgctccggccccggctcccgaaccgaagcccgagcccaagccggagcccgct
ccggctgctgccgccccggcccccgcgcctgctccggctccggctcgggctccggagccc
aagccggcccccaagcccgccccggctcccgcggcgcaggctcccgctccggccgctccc
gcgcccgccgcgaacggcgcgacgccgtacgtcaccccgctggtgcgcaagctggccgag
gagaacggcgtcgacctgtccaccctcaccggttccggtgtcggtggccgcatccgcaag
caggatgtgctggccgccgccgaggcgaagaaggccccggctccggccgccgccgcgccc
gccaaggccgctccggccgcgaaggcgcccgccgccgccaagccggaactggcgcatctg
cgtggcaccacccagaaggccaaccgcatccgccagatcaccgcgaccaagacgcgggaa
tcgctgcagaccaccgcgcagctgacccaggtccacgaggccgacgtcaccaagatcgcg
gccctgcgggcacaggccaaggccgcgttcaaggagcgcgagggcgtcaacctgacgttc
ctgccgttcttcgccaaggccgtggtcgaggcgctgggtgtgcaccccaacgtcaacgcc
agctacgacgagggcaccaaggagatcacctaccacgccgcggtgcacctgggcatcgcc
gtggacaccgagcagggcctgctgtccccggtgatccacaacgccagcgacctgtcgctg
gccgggctcgcgcgcgccatcgccgatatcgccgatcgcgcccgcaacggtggcctcaag
cccgacgagctggccggtggcaccttcaccatcaccaatatcggcagccagggcgcgctg
ttcgacaccccgatcctggttccgccgcaggcggccatgctcggtacgggtgcgatcgtc
aagcgtccggtcgtggtcaccgacgagaccggcaacgagtcgatcggtgtgcggtcgatg
tgctacctgccgctgacctacgatcaccgcctgatcgacggcgccgacgcgggtcgtttc
ctcaccacgatccggcatcggctcgaagaggcggcgttcgaggctgacctcggcctgtaa

DBGET integrated database retrieval system