KEGG   Nocardia cyriacigeorgica: NOCYR_1829Help
Entry
NOCYR_1829        CDS       T01756                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NOCYR_1829
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOCYR_1829
   00052 Galactose metabolism
    NOCYR_1829
   00500 Starch and sucrose metabolism
    NOCYR_1829
   00520 Amino sugar and nucleotide sugar metabolism
    NOCYR_1829
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NOCYR_1829
   00524 Butirosin and neomycin biosynthesis
    NOCYR_1829
Enzymes [BR:ncy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NOCYR_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2045880..2046890)
Genome map
AA seq 336 aa AA seqDB search
MTAAAAGSHPLTVGIDVGGTNIRASVVDSEGSVLDTVQAPTPHSARALDDALDRAVRELA
SRHRIDAVGLAVAGFVNGDHTTVRFAPHLPWQDAPVAARLTDRLGLPVLLEHDANAAMWA
EYRFGAAAGGHNVVLVAIGTGIGAALLIDGKLYRGTHGIAPELGHLQVVPDGRACACGKR
GCWERYCSGTALADTAIELLATEPGPSMLAREVLRDPGSLTGRRVAGAAQDGDPLALRAM
TDFARWLGLGLAFVADIFDPDLVVIAGGVSSSAPLFLDDARDEYAATLTGRGHRPLARIR
TTQLGEAAGMIGAAEMARAALASPGGDMSSVAHTGR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagcggcggcgggttcgcacccactgaccgtcggaatcgacgtcggcggcacc
aatatccgtgcctcggtcgtcgacagcgagggttcggtgctcgacaccgtgcaggcgccc
acaccgcattcggcgcgcgcgctcgacgacgctctcgaccgggccgtgcgcgaactcgcc
tcccggcatcgcatcgacgcggtggggctcgcggtggccgggttcgtcaacggcgatcac
accaccgtccggttcgcaccgcatctgccctggcaggacgcacccgtcgcggcgcggctg
accgaccggctgggcctgccggtgctgctggaacacgacgcgaacgcggccatgtgggcc
gaataccggttcggcgcggcggccggcgggcacaacgtggtgctggtcgcgatcggcacc
ggcatcggcgccgcgctgctcatcgacggcaagctctatcgcggcacccacggcatcgca
cccgaactcggccatctgcaagtggttccggacgggcgcgcctgcgcctgcggtaaacgc
ggctgctgggagcgttattgcagcgggacggcactggccgataccgcaatcgaactgctc
gccaccgaacccggcccatcgatgctggccagggaggtgctgcgggatccgggttcgctc
accggccgtcgcgtcgcgggcgcggcccaggacggtgatccgctcgcgctgcgcgccatg
accgatttcgcccgctggctcggactcggcctggccttcgtcgccgacatcttcgatccg
gatctggtcgtgatcgcgggcggggtgagcagttcggcgccgctgttcctcgacgacgcc
cgcgacgagtacgccgccaccctcaccggccgcggccaccgcccgctggcccgcatccgc
accacccagctcggggaggcggcgggcatgatcggcgccgcggagatggcacgggccgcc
ctcgcctcgcccggcggtgacatgtcctcggtcgcgcacaccggtcgctga

DBGET integrated database retrieval system