KEGG   Nocardia cyriacigeorgica: NOCYR_1845Help
Entry
NOCYR_1845        CDS       T01756                                 

Gene name
qcrB
Definition
Cytochrome b of cytochrome c reductase complex
Orthology
K03891  
ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    NOCYR_1845 (qcrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2061170..2062810
Genome map
AA seq 546 aa AA seqDB search
MSSPSAIGRKVGAHADAVDERYRAAAFMRRSINKVFPTHWSFLLGEIALYAFIILLLSGV
YLTLYFDPSMSHVVYDGAYQPLRGVGMSRAYETALNISFEVRGGLFVRQVHHWAALLFAA
SIIVHLLRIFFTGAFRKPREANWVIGSLLLILAMFEGFFGYSLPDDLLSGTGLRAAFSGI
TIGVPVIGTWLHWLMFGGDFPGEIIIPRLYIAHVLLFPGIMLALIAAHVAIVWYQKHTQF
PGPGRTENNVVGARIVPVFAADQGAFFAFTLGFVGIMGGVLQINPIWNLGPYNPSQVSAG
SQPDFYMMWTDGMARLMPPWELYLGRYTVPAVFWVALVMGLVFTLLIAYPWIEKRLTKDN
ANHNLLQRPRDVPVRTAIGAMAITFYVILTLACVNDIISLKFDISLNATTWVGRIGLLLG
PPIAYFLTYRFCIGLQRSDRAVLEHGIETGVIKRLPHGEYIEVHQPLGPVDDHGHPIPLE
YQGAPVPKKMNQLGSAGQPGTGSFLRPDPWQESEQHFATELEEEHKQLAVLRKAQENANG
HGKHSH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagttctccatcagcaatcggccggaaggtcggtgcccacgccgacgccgtggacgag
cggtaccgcgccgccgcgttcatgcgccggtcgatcaacaaggtcttcccgacccactgg
tcgttcctgctgggtgagatcgcgctgtacgcgttcatcatcctgctgctgtcgggtgtc
tacctgacgctgtacttcgacccgtcgatgagccacgtcgtgtacgacggcgcctaccag
ccgctgcgcggtgtcggtatgtcgcgggcctacgagaccgcgctgaacatctccttcgag
gtgcgcggcggcctgttcgtgcgccaggtgcatcactgggcggcgctgctgttcgcggcc
tcgatcatcgtgcacttgctgcgcatcttcttcaccggtgcgttccgcaagccgcgtgag
gcgaactgggtgatcggttcgctgctgctgatcctggcgatgttcgagggcttcttcggt
tactcgctgcccgacgacctgctctccggtaccggtctgcgggccgcgttctccggcatc
accatcggtgttccggtcatcggcacctggttgcactggctgatgttcggtggcgacttc
ccgggcgagatcatcatcccgcgcctctacatcgcgcacgtgctgctgttccccggcatc
atgctggcgctgatcgccgcgcacgtggccatcgtctggtaccagaagcacacccagttc
cccggcccgggccgcaccgagaacaacgtcgtcggtgcccgcatcgtgccggtgttcgcc
gccgaccagggcgcgttcttcgccttcaccctcggcttcgtcggcatcatgggtggcgtc
ctgcagatcaacccgatctggaacctgggcccgtacaacccgtcgcaggtctcggccggt
tcacagcccgacttctacatgatgtggaccgacggtatggcgcgtctgatgccgccgtgg
gagctctacctgggccgctacacggtcccggcggtgttctgggtcgcgctggtgatgggc
ctggtgttcaccctgctgatcgcctacccgtggatcgagaagcggctcaccaaggacaac
gccaaccacaacctgttgcagcgtccgcgcgacgtgccggtgcgtaccgcgatcggtgcc
atggcgatcaccttctacgtgatcctgaccctggcctgcgtcaacgacatcatctcgttg
aagttcgacatctcgctgaacgccaccacctgggtcggccgtatcggcctgctgctcgga
ccgccgatcgcgtacttcctgacctaccggttctgcatcggcctgcagcgcagtgaccgc
gcggtgctcgagcacggcatcgagaccggtgtgatcaagcgcctgccgcacggtgagtac
atcgaggtgcaccagccgctgggcccggtcgacgaccacggccacccgatcccgctggag
taccagggcgccccggtgcccaagaagatgaaccagctgggttcggccggccagcccggt
accggtagcttcctgcgcccggatccgtggcaggagagcgagcagcacttcgccaccgag
ctggaggaggagcacaagcagctcgcggtgctgaggaaggcacaggagaacgccaacggc
catggcaagcacagccactga

DBGET integrated database retrieval system