KEGG   Nocardia cyriacigeorgica: NOCYR_1904Help
Entry
NOCYR_1904        CDS       T01756                                 

Gene name
acsA
Definition
(GenBank) Acetyl-coenzyme A synthetase (Acetate--CoA ligase) (Acyl-activating enzyme)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00010  Glycolysis / Gluconeogenesis
ncy00620  Pyruvate metabolism
ncy00640  Propanoate metabolism
ncy00680  Methane metabolism
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOCYR_1904 (acsA)
   00620 Pyruvate metabolism
    NOCYR_1904 (acsA)
   00640 Propanoate metabolism
    NOCYR_1904 (acsA)
  Energy metabolism
   00680 Methane metabolism
    NOCYR_1904 (acsA)
Enzymes [BR:ncy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NOCYR_1904 (acsA)
Lipid biosynthesis proteins [BR:ncy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NOCYR_1904 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCF62690
UniProt: H6RD46
Position
complement(2130962..2132914)
Genome map
AA seq 650 aa AA seqDB search
MTTVTVDHLDSPAAYPPPADFAANANAGAALYDRAAADRLEFWAEQARRLHWDRPWSQVL
DWSNAPYAEWFAGGTLNVAYNCVDRHVLDGHGDQVAIHWEGEPGDSRSITYRELLAEVSK
AANYFTELGLVAGDRVAIYMPMVPEAIVAMLACARLGLTHSVVFAGFSPAALRQRVDDAG
ARLVVTTDGQWRRGKPAPLKAAVDEALGAAGETTVEHVLVVRRTEIDTPWTEGRDLWWHE
TVAQASPEHEAQAFDAEHPLFILYTSGTTGKPKGILHTSGGYLTQTAYTHHYAFDHKPGA
DVYWCTADIGWVTGHSYIVYGPLANRATQVVYEGTPNSPDEHRHFEIIEKYGVTIYYTAP
TLIRTFMKWGRQIPDAHDLSSIRLLGSVGEPINPEAWRWYREVIGAGTAPIVDTWWQTET
GSIMISPLPGVTATKPGAAMAPLPGISARVVDDDGAGLDRDRSGLLVLDQPWPSMLRGIW
NDPQRFQETYWDRFRESGWYFAGDGARLDADGDLWVLGRVDDVMNVSGHRISTAEVESAL
VSHRAVAEAAVVGASDATTGQAIVAFAILTAEAGAGEPDRDALIAQLKAEVAQQISPIAR
PRDIHLVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPAVFESIARG
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaccgtcaccgtcgaccatctcgacagccccgccgcctacccgccgcccgccgac
ttcgccgcgaacgccaatgccggtgccgccctgtacgaccgggcggccgcggaccggctc
gaattctgggccgaacaggcccgccggctgcactgggaccggccgtggagccaggtgctg
gattggagcaacgcgccgtacgcggagtggtttgccggcggcaccctcaatgtggcctac
aactgcgtcgaccggcatgtgctcgacggccacggcgatcaggtcgccatccattgggaa
ggtgagccgggcgattcccgctcgatcacctaccgcgagctgctggcggaggtcagcaag
gctgcgaactacttcaccgagctggggctggtcgccggggatcgggtcgccatctacatg
ccgatggtgccggaggcgatcgtggcgatgctcgcgtgtgcgcggctgggcctgacgcat
tcggtggtgttcgccggtttctcgccggccgcgctgcgccagcgcgtcgacgatgccggc
gcgcggctggtggtgaccaccgacgggcagtggcggcgcggtaagcccgcaccgctgaag
gctgcggtggacgaagcactgggcgcggccggcgagaccaccgtcgaacacgtcctggtg
gtgcgccgcaccgagatcgacactccgtggaccgagggccgggacctgtggtggcacgag
accgtcgcgcaggcctcccccgaacacgaagcccaagccttcgacgccgaacacccgctg
ttcatcctctacacctccggcaccaccggaaaacccaaaggcatcctgcacaccagcggc
ggctacctcacccagaccgcctacacccaccactacgccttcgaccacaaacccggcgcc
gacgtctactggtgcaccgccgacatcggctgggtcaccggccacagctacatcgtctac
ggccccctcgccaaccgcgccacccaggtcgtctacgagggcacacccaactcgccggac
gagcaccggcatttcgagatcatcgaaaagtacggcgtcaccatctattacacggcgccc
actttgatccggacgttcatgaagtggggcaggcagattccggacgcgcacgacctgtcc
tcgatccgcctgctgggttcggtcggtgagccgatcaatccggaggcctggcggtggtac
cgcgaggtgatcggcgcgggcacggcgcccatcgtcgatacctggtggcagaccgagacc
gggtcgatcatgatctcgccgctgcccggcgtcaccgccaccaaaccgggtgcggccatg
gcaccgctgcccggcatctcggcccgggtcgtcgacgacgacggcgccggactcgaccgt
gaccggtccggcctgctggtgctcgatcagccgtggccgtcgatgctgcgcggcatctgg
aacgatccgcaacggttccaggagacctactgggaccggttccgcgaatccggctggtat
ttcgccggtgacggcgcccgcctggacgccgacggcgacctgtgggtgctgggccgcgtc
gacgacgtcatgaatgtctccggccaccgcatctccaccgccgaagtggagtcggcgctg
gtctcccaccgcgccgtcgccgaagccgccgtggtgggcgccagcgatgccaccaccggc
caggccatcgtcgccttcgccatcctcaccgccgaggccggcgccggcgagccggaccgc
gacgcactgatcgcccagctgaaagccgaagtggcccagcagatcagcccgatcgcccgg
ccgcgcgatatccacctggtaccggagctgcccaagacccgcagcggcaagatcatgcgc
cggctgctgcgcgatgtggccgagggccgcgaactcggcgacacctccaccctggtcgac
ccggcggtgttcgagtccatcgcccgcgggtaa

DBGET integrated database retrieval system