KEGG   Nocardia cyriacigeorgica: NOCYR_2000Help
Entry
NOCYR_2000        CDS       T01756                                 

Gene name
hisD
Definition
Histidinol dehydrogenase (HDH)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ncy01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ncy00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2231388..2232725
Genome map
AA seq 445 aa AA seqDB search
MTSRIELARVDLRGRTPSAAELRTALPRGGVDVDSVLHQVRPVVEAIRDRGVAAAQEFSE
KFDGVVPPAVRVPEAELAAALDKLDPAVRAALEVAIERTRTVHADQRRTDTVTEVVPGGT
VTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVESLVVASPPQAQFGGLPHPTIL
AAARLLGVDEVWAVGGAQAVALLTYGGTDTTGEQLAPVDMITGPGNIYVTAAKRLCRGLV
GIDAEAGPTEIAILADSTADPVHVAADLISQAEHDVLAASVLVTDSVALADAVDAALSAQ
LTVVKHAHRVTEALTGAQSGTVLVDDIEQGLRVVNAYAAEHLEIQTADAPAVAARVRSAG
AVFVGAYAPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVAGH
VVALANAEDLPAHGQAVQARFEALS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgcatcgagctcgcccgcgtcgatttgcgcggtcgtactccctccgctgcc
gagctgcgcaccgcgctgccgcgcgggggagtcgacgtggactcggtgctgcatcaggtg
cgtccggtggtcgaggcgatccgcgaccgtggcgtggccgcggcacaggaattcagcgag
aagttcgacggggtcgtcccgcccgccgtgcgcgtgcccgaggccgaactggccgccgcg
ctcgacaagctcgacccggccgtgcgggccgcgctcgaggtcgccatcgaacgcaccagg
accgtgcacgccgatcagcggcgcaccgacaccgtcaccgaggtagtgcccggcggcacc
gtcaccgagcggtgggttccggtcgagcgggtcgggctgtacgtgccgggcggcaacgcg
gtctacccgtccagcgtcgtgatgaacgtggtcccggcgcaggccgcgggcgtggaatcg
ctggtggtggcctcgccgccgcaggcccagttcggcggactgccgcacccgaccatcctg
gccgcggcgcgactgctcggcgtcgacgaggtgtgggcggtcggcggcgcgcaggccgtg
gccttgctgacctacggcggcaccgacaccaccggtgagcagctggcgccggtcgacatg
atcaccggccccggcaatatttacgtcaccgccgccaagcggctgtgccgcggtctggtg
ggtatcgacgccgaggcgggccccaccgagatcgccatcctcgccgactccaccgccgat
ccggtgcacgtggccgccgacctgatcagccaggccgaacacgatgtgctggccgccagc
gtgctggtcaccgacagcgtcgccctcgccgacgccgtcgacgccgcgctctcggcgcag
ctgacggtggtcaagcacgcgcaccgggtcaccgaggcgctcaccggcgcccagtccggc
acggtgctggtcgacgacatcgaacagggcctgcgcgtggtcaacgcttacgccgccgaa
cacctcgagatccagaccgccgacgccccggccgtggccgcgcgggtgcgcagtgcgggt
gcggtgttcgtcggcgcgtatgccccggtcagcctgggtgactattgcgcgggctccaac
cacgtgctgcccaccgcgggctgtgcgcggcactcctcgggcctgagcgtgcaaaccttc
ctgcgcggcatccacgtcgtggagtacaccgaggcggcattgaaggacgtcgccggtcac
gtggtggcgctggccaatgccgaggatctgcccgcccacgggcaggccgtgcaggcgcgg
ttcgaggcgctgtcgtga

DBGET integrated database retrieval system