KEGG   Nocardia cyriacigeorgica: NOCYR_2021Help
Entry
NOCYR_2021        CDS       T01756                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NOCYR_2021 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NOCYR_2021 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NOCYR_2021 (trpB)
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NOCYR_2021 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2253636..2254907
Genome map
AA seq 423 aa AA seqDB search
MAGTRLPAASEGVAHRSGHEPDGGGHFGVYGGRHVPEALMAVIEEVTAEYDKVRSDREFL
GELDRLQRDYTGRPSPVFECTRLAEHAGGARILLKREDLNHTGSHKINNVLGQALLAKRM
GKTRVIAETGAGQHGVATATACALLGLDCIVYMGAVDTARQALNVARMRLLGAEVVSVST
GSATLKDAINEALRDWVSNADDTYYCFGTAAGPHPFPLMVRDFQRVVGLEAREQVQELTG
RLPDAVAACVGGGSNAIGIFHAFIDDPGVRLVGYEAAGDGVETGRHAATFTGGSPGAFQG
AYSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLKDTGRAEYLPVTDTAAMDALLLLSR
SEGIIPAIESAHAVAGALELGKQLGPGAIILVNLSGRGDKDMDTAARWFGLFDDDAAEGK
GNG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccggcacccggctgcccgcggccagcgagggcgtcgcccaccgcagcggacacgaa
cccgacggcggcggccacttcggcgtctacggcggcaggcatgtgcccgaggcgctgatg
gccgtcatcgaagaggtcaccgccgaatacgacaaggtgcgcagcgaccgcgagttcctg
ggcgaactcgaccggctgcagcgcgactacaccggccgcccctcgccggtcttcgaatgc
acccgactggccgagcacgccggcggcgcccgcatcctgctcaagcgcgaagacctcaac
cacaccggctcgcacaagatcaacaacgtgctgggccaggcgttgctggccaagcgcatg
ggcaagacccgcgtcatcgccgagaccggcgccggccagcacggcgtggccaccgcgacg
gcctgtgcgctgctcgggctggactgcatcgtctacatgggcgcggtcgacaccgcccgc
caggcgctcaacgtggcccggatgcggctgctcggcgccgaggtcgtatccgtgagcacc
ggctccgccacgctcaaggacgccatcaacgaggccctgcgcgactgggtctccaacgcc
gacgacacctactactgcttcggcaccgccgcgggcccgcacccgttcccgctgatggtg
cgcgatttccagcgcgtggtcggcctcgaggcgcgtgagcaggtgcaggagctcaccggc
aggctgcccgacgccgtcgcggcctgcgtcggcggcggctccaacgccatcggcatcttc
cacgccttcatcgacgatccgggcgtgcgcctggtcggttacgaagccgcgggcgacggt
gtcgagaccggccgccacgccgccaccttcaccggcggatcgcccggcgcgttccagggc
gcctactcgtacctgttgcaggacgaggacggccagaccatcgaatcgcattccatctcc
gccggactcgactatcccggcgtcggccccgagcacgcctacctcaaggacaccggccgc
gccgaatacctgccggtcaccgataccgccgcgatggacgcgctgctgctgctcagccgc
tccgaaggcatcatcccggcgatcgaatccgcgcacgcggtggcgggcgcgctcgagctc
ggcaagcagctcggcccgggcgcgatcatcctggtgaacctgtccggtcgcggcgacaag
gacatggacaccgcggcccgctggttcgggctgttcgacgacgacgccgccgaaggcaag
gggaacgggtag

DBGET integrated database retrieval system