KEGG   Nocardia cyriacigeorgica: NOCYR_2021Help
Entry
NOCYR_2021        CDS       T01756                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00260  Glycine, serine and threonine metabolism
ncy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01130  Biosynthesis of antibiotics
ncy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NOCYR_2021 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NOCYR_2021 (trpB)
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NOCYR_2021 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: CCF62806
UniProt: H6QZ52
Position
2253636..2254907
Genome map
AA seq 423 aa AA seqDB search
MAGTRLPAASEGVAHRSGHEPDGGGHFGVYGGRHVPEALMAVIEEVTAEYDKVRSDREFL
GELDRLQRDYTGRPSPVFECTRLAEHAGGARILLKREDLNHTGSHKINNVLGQALLAKRM
GKTRVIAETGAGQHGVATATACALLGLDCIVYMGAVDTARQALNVARMRLLGAEVVSVST
GSATLKDAINEALRDWVSNADDTYYCFGTAAGPHPFPLMVRDFQRVVGLEAREQVQELTG
RLPDAVAACVGGGSNAIGIFHAFIDDPGVRLVGYEAAGDGVETGRHAATFTGGSPGAFQG
AYSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLKDTGRAEYLPVTDTAAMDALLLLSR
SEGIIPAIESAHAVAGALELGKQLGPGAIILVNLSGRGDKDMDTAARWFGLFDDDAAEGK
GNG
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccggcacccggctgcccgcggccagcgagggcgtcgcccaccgcagcggacacgaa
cccgacggcggcggccacttcggcgtctacggcggcaggcatgtgcccgaggcgctgatg
gccgtcatcgaagaggtcaccgccgaatacgacaaggtgcgcagcgaccgcgagttcctg
ggcgaactcgaccggctgcagcgcgactacaccggccgcccctcgccggtcttcgaatgc
acccgactggccgagcacgccggcggcgcccgcatcctgctcaagcgcgaagacctcaac
cacaccggctcgcacaagatcaacaacgtgctgggccaggcgttgctggccaagcgcatg
ggcaagacccgcgtcatcgccgagaccggcgccggccagcacggcgtggccaccgcgacg
gcctgtgcgctgctcgggctggactgcatcgtctacatgggcgcggtcgacaccgcccgc
caggcgctcaacgtggcccggatgcggctgctcggcgccgaggtcgtatccgtgagcacc
ggctccgccacgctcaaggacgccatcaacgaggccctgcgcgactgggtctccaacgcc
gacgacacctactactgcttcggcaccgccgcgggcccgcacccgttcccgctgatggtg
cgcgatttccagcgcgtggtcggcctcgaggcgcgtgagcaggtgcaggagctcaccggc
aggctgcccgacgccgtcgcggcctgcgtcggcggcggctccaacgccatcggcatcttc
cacgccttcatcgacgatccgggcgtgcgcctggtcggttacgaagccgcgggcgacggt
gtcgagaccggccgccacgccgccaccttcaccggcggatcgcccggcgcgttccagggc
gcctactcgtacctgttgcaggacgaggacggccagaccatcgaatcgcattccatctcc
gccggactcgactatcccggcgtcggccccgagcacgcctacctcaaggacaccggccgc
gccgaatacctgccggtcaccgataccgccgcgatggacgcgctgctgctgctcagccgc
tccgaaggcatcatcccggcgatcgaatccgcgcacgcggtggcgggcgcgctcgagctc
ggcaagcagctcggcccgggcgcgatcatcctggtgaacctgtccggtcgcggcgacaag
gacatggacaccgcggcccgctggttcgggctgttcgacgacgacgccgccgaaggcaag
gggaacgggtag

DBGET integrated database retrieval system