KEGG   Nocardia cyriacigeorgica: NOCYR_2022Help
Entry
NOCYR_2022        CDS       T01756                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00260  Glycine, serine and threonine metabolism
ncy00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01130  Biosynthesis of antibiotics
ncy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NOCYR_2022 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NOCYR_2022 (trpA)
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NOCYR_2022 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth Pterin_bind HisG_C
Motif
Other DBs
NCBI-ProteinID: CCF62807
UniProt: H6QZ53
Position
2254907..2255707
Genome map
AA seq 266 aa AA seqDB search
MSQQSRLADTFAACRAEHRAALIGYLPAGYPDLDGSIATVRAMVEAGCDIVEVGVAYSDP
VMDGPTIQQAAEQALRNGVRVRDVFSVVEAVTAAGAQAVVMSYWNPVLKYGVDRFARDLA
AAGGAGIITPNLIPDEADEWFAASTAHDLDRIFLVAPSSTEERLVKTLEASRGFVYAAST
MGVTGARDAVSSAAPALCARVRAHSDIPIGVGLGVRSGAQAAEIAAYADGVIVGSALVTA
AAEGLDAVRTLTAELADGVRSATVAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagcagtccagactcgccgacaccttcgcggcctgccgcgccgaacaccgcgcc
gccctgatcggctacctgcccgccggctacccggatctggacggctccatcgccaccgtg
cgcgccatggtcgaggccggctgcgacatcgtcgaggtcggtgtggcctactccgatccg
gtgatggacgggccgaccatccagcaggccgccgagcaggcgctgcgcaacggagtgcgg
gtgcgcgatgtgttctccgtggtcgaggccgtcaccgcggccggtgcccaggccgtggtg
atgagctactggaatccggtgctcaagtacggcgtggaccggttcgcccgggacctcgcg
gccgcgggcggcgccggcatcatcaccccgaacctgatccccgacgaggccgacgagtgg
ttcgccgcttcgaccgcccatgatttggaccggatcttcctggtcgccccgtcctcgacc
gaggagcgcctggtcaagaccctggaggcttcgcgcggattcgtctacgccgcctccacc
atgggcgtgaccggcgcccgtgacgccgtgtcctcggccgcgcccgcgctgtgtgcccgg
gtccgcgcacactccgacatcccgatcggggtgggtctcggcgtgcgttccggtgcccag
gccgccgagatcgccgcctacgccgacggcgtgatcgtcggttcggcgttggtcaccgcg
gccgccgagggcttggacgcggtgcggacgctgacggccgagctggccgacggcgtgcgc
tcggcgaccgtcgcgtcctga

DBGET integrated database retrieval system