KEGG   Nocardia cyriacigeorgica: NOCYR_2022Help
Entry
NOCYR_2022        CDS       T01756                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NOCYR_2022 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NOCYR_2022 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NOCYR_2022 (trpA)
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NOCYR_2022 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2254907..2255707
Genome map
AA seq 266 aa AA seqDB search
MSQQSRLADTFAACRAEHRAALIGYLPAGYPDLDGSIATVRAMVEAGCDIVEVGVAYSDP
VMDGPTIQQAAEQALRNGVRVRDVFSVVEAVTAAGAQAVVMSYWNPVLKYGVDRFARDLA
AAGGAGIITPNLIPDEADEWFAASTAHDLDRIFLVAPSSTEERLVKTLEASRGFVYAAST
MGVTGARDAVSSAAPALCARVRAHSDIPIGVGLGVRSGAQAAEIAAYADGVIVGSALVTA
AAEGLDAVRTLTAELADGVRSATVAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagccagcagtccagactcgccgacaccttcgcggcctgccgcgccgaacaccgcgcc
gccctgatcggctacctgcccgccggctacccggatctggacggctccatcgccaccgtg
cgcgccatggtcgaggccggctgcgacatcgtcgaggtcggtgtggcctactccgatccg
gtgatggacgggccgaccatccagcaggccgccgagcaggcgctgcgcaacggagtgcgg
gtgcgcgatgtgttctccgtggtcgaggccgtcaccgcggccggtgcccaggccgtggtg
atgagctactggaatccggtgctcaagtacggcgtggaccggttcgcccgggacctcgcg
gccgcgggcggcgccggcatcatcaccccgaacctgatccccgacgaggccgacgagtgg
ttcgccgcttcgaccgcccatgatttggaccggatcttcctggtcgccccgtcctcgacc
gaggagcgcctggtcaagaccctggaggcttcgcgcggattcgtctacgccgcctccacc
atgggcgtgaccggcgcccgtgacgccgtgtcctcggccgcgcccgcgctgtgtgcccgg
gtccgcgcacactccgacatcccgatcggggtgggtctcggcgtgcgttccggtgcccag
gccgccgagatcgccgcctacgccgacggcgtgatcgtcggttcggcgttggtcaccgcg
gccgccgagggcttggacgcggtgcggacgctgacggccgagctggccgacggcgtgcgc
tcggcgaccgtcgcgtcctga

DBGET integrated database retrieval system