KEGG   Nocardia cyriacigeorgica: NOCYR_2331Help
Entry
NOCYR_2331        CDS       T01756                                 

Gene name
echA
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NOCYR_2331 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NOCYR_2331 (echA)
   00650 Butanoate metabolism
    NOCYR_2331 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    NOCYR_2331 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOCYR_2331 (echA)
   00310 Lysine degradation
    NOCYR_2331 (echA)
   00360 Phenylalanine metabolism
    NOCYR_2331 (echA)
   00380 Tryptophan metabolism
    NOCYR_2331 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NOCYR_2331 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NOCYR_2331 (echA)
   00281 Geraniol degradation
    NOCYR_2331 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOCYR_2331 (echA)
   00627 Aminobenzoate degradation
    NOCYR_2331 (echA)
   00930 Caprolactam degradation
    NOCYR_2331 (echA)
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NOCYR_2331 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2578085..2579104
Genome map
AA seq 339 aa AA seqDB search
MSDKQSHSGTRPAAWYENWTEGPESPWQGRPEPADEHEYPTLTYQRDGRIARLTFNRPEK
GNTITPDTPRDLADAVERADLDPRVHVILLSGRGKGFCGGYDLDMFAEKGFTPTGGPDEV
SGTVVDPLVNAVNHNPWGTWDPMIDYAMMSRFNRGFASLMQANKPTVAKLHGFAIAGGTD
IALYADQIICADDTKIGYPPTRTWGIPAGGMWAHRLGDQRAKRLLFTGDCLSGKQAEEWG
LAVESCPADELDERTEALVARIARMPVNQLMMAKLALNSALYNQGVANSGMISTVFDGIS
RHTREGYAFQLRAATVGFREAVRERDEPYGDYKRAQFER
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgacaagcaatcccattccggaacccggcccgcggcgtggtacgagaactggacc
gaagggccggaatcgccgtggcagggccggcccgaacctgccgacgaacacgagtatccg
acgctgacctaccagcgcgacgggcgcatcgcccgcctcacgttcaaccggcccgagaag
ggcaacacgatcacccccgacaccccgcgcgatctggccgacgcggtcgagcgcgcggat
ctggatccgcgggtgcacgtcatcctgctgtcgggccgcggtaagggcttctgcggcggc
tacgacctggacatgttcgccgaaaaggggttcacgccgaccggtgggcccgatgaggtg
tccgggaccgtggtggatccgctggtcaacgcggtcaaccacaacccgtggggcacctgg
gatccgatgatcgactacgcgatgatgagccggttcaaccgtggcttcgccagcctcatg
caggccaacaagccgacggtggccaaactgcacggtttcgccatcgcgggcggcaccgat
atcgccctgtatgccgatcagatcatctgcgccgacgacaccaagatcggctacccgccc
acccgcacctggggcattcccgccggcggcatgtgggcgcaccggctcggcgaccagcgc
gccaagcggttgctgttcaccggcgactgtctcagcggcaaacaggccgaggagtggggt
ctcgcggtggaatcgtgcccggccgacgaactcgacgaacgcaccgaagcgctggtggcg
cgaatcgcgcggatgccggtcaaccagctgatgatggccaaactcgccctgaactcggcg
ctctacaaccagggcgtggccaactccgggatgatcagcacggtcttcgacggaatctcc
cggcacacccgcgaggggtacgccttccagttgcgcgcggccaccgtcggtttccgggag
gcggtgcgtgaacgcgacgagccgtacggcgattacaagcgggcgcagttcgagcgctga

DBGET integrated database retrieval system