KEGG   Nocardia cyriacigeorgica: NOCYR_2577Help
Entry
NOCYR_2577        CDS       T01756                                 

Gene name
glcB
Definition
Malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ncy01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ncy00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ncy00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2850917..2853097
Genome map
AA seq 726 aa AA seqDB search
MTERIQVGGLQVARVLHEFVENEALPGTGVDSAAFWAGAEQVINDLAPRNRALLAERDEI
QGKLDAWHGENPGANYDKAAYKNFLTEIGYLRPEPADFQIDTQNVDDEIATTAGPQLVVP
VMNARFAINAANARWGSLYDALYGTDAISEDNGAEKGKGYNKVRGDKVIEWARNFLDDAV
TLITGSHIGSTSYKIVDGELEVGLEDGTEIGLADASQLVGYKGEPDAPTSILLKHNGLHI
EIQIDPESPIGSTDTAGIKDVVLESAVTTIMDFEDSVAAVDAEDKVLCYHNWLGLMKGTL
AEEVSKGGKTFTRTMNPDRVYTALDGSELVLHGRSLLFVRNVGHLMTSDAILDAEGNEVP
EGIMDGLITSLIAKHSLGGDAELKNSRTGSVYIVKPKMHGPDEVAFTNELFGRVEDVIGV
PRNTLKVGIMDEERRTTVNLKACIAAAKDRVVFINTGFLDRTGDEIHTSMEAGPMVRKAD
MKAQQWIASYEDWNVDTGLATGLPGKAQIGKGMWAMPDLMADMLVQKIGHPKAGANTAWV
PSPTAATLHATHYHLVDVFKRQAELAKGGARATVDQILEIPLAADINWSAEEKQQELDNN
SQSILGYVVRWIDQGVGCSKVPDIKDVALMEDRATLRISSQLMANWLRHGIVSAEDVIAS
LERMAPVVDRQNAGDPNYRPMAPDFAGSVAFQAAKELILEGTKQPNGYTEPILHRRRREA
KALAAK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcggattcaggtcggcgggctacaggtggcacgcgttctccacgagttcgta
gagaacgaggcgcttccgggtaccggcgtggattccgccgcgttctgggccggtgcggag
caggtgatcaacgatctcgccccgcgtaaccgcgccctgctcgccgaacgcgacgagatc
cagggcaagctcgacgcctggcacggggagaacccgggcgcgaactacgacaaggccgcc
tacaagaacttcctgaccgaaatcggctacctgcgtcccgagccggccgatttccagatc
gacacccagaacgtcgacgacgagatcgccaccaccgccggcccgcagctggtggtgccg
gtgatgaacgcgcgcttcgcgatcaacgccgccaacgcccgctggggttcgctctacgac
gccctctacggcaccgacgccatctccgaggacaacggcgcggagaagggcaagggctac
aacaaggtccgcggcgacaaggtcatcgagtgggcgcgcaacttcctcgacgacgccgtc
accctgatcaccggctcgcacatcggctccacctcctacaagatcgtcgacggtgagctc
gaggtcggcctggaggacggcaccgagatcggcctggccgacgcctcgcagctggtcggt
tacaagggcgagcccgatgccccgacctcgatcctgctgaagcacaacggcctgcacatc
gagatccagatcgatcccgaatcgccgatcggcagcaccgacaccgcgggcatcaaggac
gtggtgctcgagtccgccgtcaccacgatcatggacttcgaggactcggtcgccgcggtc
gacgccgaggacaaggtgctctgctaccacaactggctgggcctgatgaagggcacgctg
gccgaagaggtcagcaagggcggcaagaccttcacccgcaccatgaaccccgaccgcgtc
tacaccgcgctcgacggctccgagctggtgctgcacggtcgctcgctgctgttcgtgcgc
aacgtcggccacctgatgacctccgacgccatcctcgacgccgaaggcaacgaggtgccc
gagggcatcatggacggcctgatcacctcgctgatcgccaagcactcgctgggcggcgac
gccgagctgaagaacagccgcaccggctcggtctacatcgtgaagccgaagatgcacggc
ccggacgaggtggccttcaccaacgagctgttcggccgcgtcgaggacgtcatcggggtg
ccgcgcaacaccctcaaggtcggcatcatggacgaggagcgccgcaccacggtcaacctc
aaggcctgtatcgccgccgccaaggaccgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaggccgggccgatggtccgcaaggccgat
atgaaggcccagcagtggatcgcctcctacgaggactggaatgtcgacaccggcctggcc
accggcctgcccggcaaggcgcagatcggtaagggcatgtgggccatgcccgacctgatg
gccgacatgctggtgcagaagatcggccacccgaaggccggcgccaacaccgcctgggtg
ccctcgcccaccgccgccaccctgcacgccacccactaccacctggtggacgtgttcaag
cggcaggccgagctggccaagggcggcgcccgcgccaccgtcgaccagatcctggagatc
ccgctggccgccgacatcaactggtcggccgaggagaagcagcaggagctggacaacaac
tcccagtccatcctcggttacgtggtgcgctggatcgaccagggcgtcggctgctccaag
gtgcccgacatcaaggacgtcgcgctgatggaggaccgcgccaccctgcgtatctccagc
cagctgatggccaactggctgcgccacggcatcgtctccgccgaggacgtcatcgccagc
ctcgagcggatggccccggtcgtcgaccgccagaacgccggcgacccgaactaccgtccg
atggcacccgacttcgccggcagcgtcgccttccaggccgccaaggaactcatcctggag
ggcaccaagcagcccaacggctacacggaaccgatcctgcaccgtcgtcgccgtgaggcg
aaggcgctggctgccaagtga

DBGET integrated database retrieval system