KEGG   Nocardia cyriacigeorgica: NOCYR_2577Help
Entry
NOCYR_2577        CDS       T01756                                 

Gene name
glcB
Definition
(RefSeq) Malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NOCYR_2577 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NOCYR_2577 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    NOCYR_2577 (glcB)
Enzymes [BR:ncy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NOCYR_2577 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2850917..2853097
Genome map
AA seq 726 aa AA seqDB search
MTERIQVGGLQVARVLHEFVENEALPGTGVDSAAFWAGAEQVINDLAPRNRALLAERDEI
QGKLDAWHGENPGANYDKAAYKNFLTEIGYLRPEPADFQIDTQNVDDEIATTAGPQLVVP
VMNARFAINAANARWGSLYDALYGTDAISEDNGAEKGKGYNKVRGDKVIEWARNFLDDAV
TLITGSHIGSTSYKIVDGELEVGLEDGTEIGLADASQLVGYKGEPDAPTSILLKHNGLHI
EIQIDPESPIGSTDTAGIKDVVLESAVTTIMDFEDSVAAVDAEDKVLCYHNWLGLMKGTL
AEEVSKGGKTFTRTMNPDRVYTALDGSELVLHGRSLLFVRNVGHLMTSDAILDAEGNEVP
EGIMDGLITSLIAKHSLGGDAELKNSRTGSVYIVKPKMHGPDEVAFTNELFGRVEDVIGV
PRNTLKVGIMDEERRTTVNLKACIAAAKDRVVFINTGFLDRTGDEIHTSMEAGPMVRKAD
MKAQQWIASYEDWNVDTGLATGLPGKAQIGKGMWAMPDLMADMLVQKIGHPKAGANTAWV
PSPTAATLHATHYHLVDVFKRQAELAKGGARATVDQILEIPLAADINWSAEEKQQELDNN
SQSILGYVVRWIDQGVGCSKVPDIKDVALMEDRATLRISSQLMANWLRHGIVSAEDVIAS
LERMAPVVDRQNAGDPNYRPMAPDFAGSVAFQAAKELILEGTKQPNGYTEPILHRRRREA
KALAAK
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcggattcaggtcggcgggctacaggtggcacgcgttctccacgagttcgta
gagaacgaggcgcttccgggtaccggcgtggattccgccgcgttctgggccggtgcggag
caggtgatcaacgatctcgccccgcgtaaccgcgccctgctcgccgaacgcgacgagatc
cagggcaagctcgacgcctggcacggggagaacccgggcgcgaactacgacaaggccgcc
tacaagaacttcctgaccgaaatcggctacctgcgtcccgagccggccgatttccagatc
gacacccagaacgtcgacgacgagatcgccaccaccgccggcccgcagctggtggtgccg
gtgatgaacgcgcgcttcgcgatcaacgccgccaacgcccgctggggttcgctctacgac
gccctctacggcaccgacgccatctccgaggacaacggcgcggagaagggcaagggctac
aacaaggtccgcggcgacaaggtcatcgagtgggcgcgcaacttcctcgacgacgccgtc
accctgatcaccggctcgcacatcggctccacctcctacaagatcgtcgacggtgagctc
gaggtcggcctggaggacggcaccgagatcggcctggccgacgcctcgcagctggtcggt
tacaagggcgagcccgatgccccgacctcgatcctgctgaagcacaacggcctgcacatc
gagatccagatcgatcccgaatcgccgatcggcagcaccgacaccgcgggcatcaaggac
gtggtgctcgagtccgccgtcaccacgatcatggacttcgaggactcggtcgccgcggtc
gacgccgaggacaaggtgctctgctaccacaactggctgggcctgatgaagggcacgctg
gccgaagaggtcagcaagggcggcaagaccttcacccgcaccatgaaccccgaccgcgtc
tacaccgcgctcgacggctccgagctggtgctgcacggtcgctcgctgctgttcgtgcgc
aacgtcggccacctgatgacctccgacgccatcctcgacgccgaaggcaacgaggtgccc
gagggcatcatggacggcctgatcacctcgctgatcgccaagcactcgctgggcggcgac
gccgagctgaagaacagccgcaccggctcggtctacatcgtgaagccgaagatgcacggc
ccggacgaggtggccttcaccaacgagctgttcggccgcgtcgaggacgtcatcggggtg
ccgcgcaacaccctcaaggtcggcatcatggacgaggagcgccgcaccacggtcaacctc
aaggcctgtatcgccgccgccaaggaccgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaggccgggccgatggtccgcaaggccgat
atgaaggcccagcagtggatcgcctcctacgaggactggaatgtcgacaccggcctggcc
accggcctgcccggcaaggcgcagatcggtaagggcatgtgggccatgcccgacctgatg
gccgacatgctggtgcagaagatcggccacccgaaggccggcgccaacaccgcctgggtg
ccctcgcccaccgccgccaccctgcacgccacccactaccacctggtggacgtgttcaag
cggcaggccgagctggccaagggcggcgcccgcgccaccgtcgaccagatcctggagatc
ccgctggccgccgacatcaactggtcggccgaggagaagcagcaggagctggacaacaac
tcccagtccatcctcggttacgtggtgcgctggatcgaccagggcgtcggctgctccaag
gtgcccgacatcaaggacgtcgcgctgatggaggaccgcgccaccctgcgtatctccagc
cagctgatggccaactggctgcgccacggcatcgtctccgccgaggacgtcatcgccagc
ctcgagcggatggccccggtcgtcgaccgccagaacgccggcgacccgaactaccgtccg
atggcacccgacttcgccggcagcgtcgccttccaggccgccaaggaactcatcctggag
ggcaccaagcagcccaacggctacacggaaccgatcctgcaccgtcgtcgccgtgaggcg
aaggcgctggctgccaagtga

DBGET integrated database retrieval system