KEGG   Nocardia cyriacigeorgica: NOCYR_2754Help
Entry
NOCYR_2754        CDS       T01756                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ncy00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3055218..3056729)
Genome map
AA seq 503 aa AA seqDB search
MTDLIGALDQGTTSTRFLIFDHTATVIAGHQLEHEQILPRPGWVEHNPVEIWERSCAVIQ
TALGRHGLRARDLAAIGVTNQRETTVIWDRTTGRPLHNAIVWQDTRTDRIAAELDATAGP
LIRHRTGLPPATYFSGGKIRWLLDTQPGLRAAAERGDALFGTIDTWLLWNLTGGTRGGIH
RTDVTNAARTMLMDLDTLDWDDELLTLFDIPRAMLPAITASAHPTHYGHTSPDGPFAAAV
PITAAVGDQQAAMIGQVCFEPGQAKNTYGTGNFLLLNTGTTPVRSTNGLLTTVCYQLGDQ
SPVYALEGSIAVTGSAVQWLRDQLGIISGAAHSESLAAEVADNGGVYFVPAFSGLFAPHW
RSDARGAIVGLTRYATNAHIARATLEAICYQTRDVIDAMTDDSGVALQVLRVDGGVTANN
LCMQIQADILGVPVSRPVITETTALGAAYAAGLATCYWHDTDELRRHWREDTRWQPTWTE
HQRAHGYRGWTKALGRTLDWATP
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctcatcggcgccctcgaccaaggcaccaccagcacccgattcctgatcttc
gaccacaccgcaaccgtcatcgccggccaccagctcgaacacgagcagatcctgccgcgc
cccggctgggtcgaacacaaccccgtcgaaatctgggaacgcagctgcgcggtcatccaa
accgccctgggccgccacggactgcgcgcccgcgacctggccgccatcggcgtcaccaac
caacgcgaaaccaccgtcatctgggaccgcaccaccggccgccccctgcacaacgccatc
gtctggcaagacacccgcaccgaccgcatcgccgccgaactcgacgccaccgcaggccca
ctcatccgccaccgcaccggactaccaccggccacctacttctccggcggcaagatccgc
tggctgctcgacacccaaccgggtctgcgcgccgccgccgaacgcggcgacgccctgttc
ggcaccatcgacacctggctgctgtggaacctcaccggcggcacccgcggcggcatccac
cgcaccgacgtcaccaacgccgcccgcaccatgctcatggacctcgacaccctcgactgg
gacgacgaacttctcaccctgttcgacatcccacgcgccatgctgcccgccatcaccgcc
tccgcccaccccacccactacggccacaccagccccgacggccccttcgccgccgccgtc
cccatcaccgccgcggtgggggaccagcaggccgccatgatcggccaggtctgcttcgaa
cccggccaagccaaaaacacctacggcaccggcaacttcctgctcctcaataccggcacc
acccccgtgcgctccaccaacggcctgctcaccaccgtctgctaccaactcggcgaccaa
tcacccgtctacgccctagaaggctccatcgccgtcaccggatccgccgtgcaatggctg
cgcgaccaactcggcatcatctccggcgccgcccacagcgaatccctcgccgccgaagtc
gccgacaacggcggcgtctacttcgtgcccgccttctccggactgttcgcaccgcactgg
cgctccgacgcccgcggcgccatcgtcggcctcacccgctacgccaccaacgcccacatc
gcccgcgccaccctcgaagccatctgctaccaaacccgcgacgtcatcgacgccatgacc
gacgactccggcgtcgccctgcaagtgctgcgcgtcgacggcggcgtcaccgccaacaac
ctgtgcatgcagatccaagccgacatcctcggcgtccccgtcagccgccccgtcatcacc
gaaaccaccgccctcggcgccgcctacgccgcgggcctggccacctgctactggcacgac
accgacgaactacgccggcactggcgcgaagacacccgctggcaacccacctggaccgaa
caccaacgcgcccacggctatcgcggctggaccaaagccctcggccgcaccctcgactgg
gccaccccctga

DBGET integrated database retrieval system