KEGG   Nocardia cyriacigeorgica: NOCYR_2756Help
Entry
NOCYR_2756        CDS       T01756                                 

Gene name
glpK
Definition
glycerol kinase 2 (ATP:glycerol 3-phosphotransferase 2) (Glycerokinase 2) (GK 2)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    NOCYR_2756 (glpK)
Enzymes [BR:ncy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     NOCYR_2756 (glpK)
Exosome [BR:ncy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NOCYR_2756 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3057615..3059132
Genome map
AA seq 505 aa AA seqDB search
MRAAGRASNRFVLAVDQGTTSSRAIVYDAAGQLVSVVQREHRQLYPAAGRVEHDAAEVRR
HVEALIGRAIGAAGIAAGQVVGIGIANQRETTLLWDRRTGRPVGNAIVWQDTRTDDLVAE
LAARPDAAEVSRLSGLPLLGYFAAPRIRWLLNRDERLRDDAERGHILFGTMDSWLIWNLT
GGAHVTDVSNAGRTLLMNLHTLDWDARLLEFFGIPRAMLPDIRSSAEIYGHTVIEPAGIP
IAAALGDQQAALVGQTCFAAGETKCTYGTGAFLLSNTGTAPVFSRHGLLTTVGFRLGAEP
AHYALEGSIASTGSLVQWLRDRLGLIDAAPEIETLAATVADNGGCSVVPAFSGLFAPRWQ
AEARGVITGLTSYITRGHLARAVLEATAWQTREVVEALNADTGQPVTELRVDGGMTSNNL
LMQQISDALGIPVQRPLFAETVSLGAAYAAGLAVGLWPDLDGLRRNRHIAGRWLPTVSAA
DRDRGYRQWSRAAALSYHGTGDTGS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtgagagcggcggggcgggccagcaaccggttcgtgctggcggtcgatcagggcaccacc
tcgagccgcgccatcgtctacgacgcggcggggcagttggtgtcggtggtgcagcgtgag
catcgtcagctgtatccggcggccgggcgggtcgaacacgacgcggccgaggtgcgccgc
catgtcgaggcgttgatcgggcgcgcgatcggtgcggccgggatcgccgccgggcaggtg
gtggggatcgggatcgccaaccagcgggagacgacgctgctgtgggatcggcgcaccggc
cgcccggtcggcaatgccatcgtctggcaggacacccggaccgacgatctggtcgccgaa
ttggccgcacgccccgacgccgccgaggtgagccggctgtccgggctgccgctgctgggc
tatttcgccgccccgcgcatccgctggttgctcaaccgcgacgaacgcctgcgcgacgac
gccgaacgcggccacatcctgttcggcaccatggattcctggctgatctggaacctcacc
ggcggcgcgcacgtcaccgatgtgagcaacgccgggcgcaccctgctgatgaacctgcac
accctggactgggatgcccggctgctcgagttcttcggcatcccgcgcgcgatgctgccc
gacatccgctccagcgccgagatctacggccacaccgtcatcgagccggccgggatcccg
atcgcggccgcgctcggcgatcagcaggcggcactggtcgggcagacctgtttcgcggcc
ggggaaaccaaatgcacctacggcaccggcgcgttcctgttgtcgaataccgggaccgcg
ccggtgttttcccggcacgggctgctgaccaccgtcgggttccgcctcggtgccgaaccc
gcccactacgcgctggaagggtcgatcgcctccaccggttcgctggtgcagtggctgcgc
gaccggctcgggctcatcgacgccgcgcccgagatcgaaaccctcgccgccaccgtcgcc
gacaacggcggctgctcggtggtgccggcgttctccgggttgttcgcaccgcgctggcag
gccgaagcgcgcggggtgatcaccggactgacctcctacatcactcgcggacacctggcg
cgggcggtgctggaggccaccgcatggcagacccgggaagtggtcgaggcgttgaacgcc
gacaccgggcaaccggtgaccgagctgcgcgtcgacggcgggatgacctcgaacaatctg
ctgatgcagcagatcagcgacgcgctcgggataccggtgcagcggccgctgttcgccgaa
accgtctccctcggtgcggcctacgcggcggggctggcggtcggcttgtggccggacctg
gacggattgcgccgcaaccgccacatcgccggacgctggctacccaccgtgtcggccgcc
gaccgcgaccgcggctaccggcagtggagccgggccgccgcgctgagctaccacgggacc
ggcgacaccggcagctag

DBGET integrated database retrieval system