KEGG   Nocardia cyriacigeorgica: NOCYR_2791Help
Entry
NOCYR_2791        CDS       T01756                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NOCYR_2791
Enzymes [BR:ncy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NOCYR_2791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3091117..3092598
Genome map
AA seq 493 aa AA seqDB search
MVQQDSGMVAVRNILTRLCKRSGLSPERLRTTEIDVGPLLDLPAVRRHAHRTGLSPEEAV
LPVVRDLARHLPATHRLITDAELSLGLLREDTPDGVDLDRLYAQDLGERREYLTQQWQLL
HEAADADHIPPAPTVRSLRATPERRAFSALAGLLTTGPVFGSPVDAGITVTTTDAHEPAP
GVLTVIGDAVIDHIYRVDHVPAAGTSTRGSFEAHPGGKGLNRAVAAARLGLDVRLVAAVG
DDEAGRQILDYLRAENVDTELVSIVRDAATPVTSVMITATGVAASIGCKDDRIRLGEREL
TGPALNGALAASDAILLTFEQPLPVIEQVMARVRRMRPRPLLMVHPAPPVDAPQHLYQHL
GAVDYLMGATWELDEMVPEVKATSGDHIARHLRALGVRTVCVIDDFACTVRSEDLDLDVG
RFPAALSDSPGARAAFAGALAYRLLSARRPAQEQDYVWATAAMVATQSFGDIPGAMPLAG
EIDRLVRLGPEER
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtccagcaggactcgggcatggtcgccgtgcgcaacatcctcacgcgcctgtgcaag
cggtcgggtctgagcccggaacggttgcgcaccaccgagatcgacgtcggaccgctgctg
gatctgcccgcggtacgccgccacgcccaccgcaccggcttgtcccctgaggaggcggtg
ctgccggtggtgcgcgatctggcccgtcacctgcccgcgacccaccgtctgatcaccgat
gccgaattgtcactgggcctgttgcgcgaggacacgcccgacggtgtcgatctggatcgc
ctctacgcccaggatctcggcgagcgccgcgaatacctgacccagcagtggcagttgctg
cacgaggccgccgacgccgaccacatcccacccgcaccgacggtgcggtcgttgcgcgca
acccccgaacgtcgcgccttcagcgccctggccgggctgttgaccaccggaccggtgttc
ggctcccccgtcgacgccggcatcaccgtcaccaccacggacgcgcacgagccggcgccg
ggtgtgctgacggtgatcggcgacgcggtcatcgaccacatctaccgcgtcgaccacgtc
ccggccgcgggcacctccacccgtggcagtttcgaagctcatcccggcggcaagggcctc
aaccgcgcggtggccgccgcccggctgggcctggatgtgcggttggtggccgccgtcggt
gacgacgaggcgggccggcagatcctggattatctgcgcgcggagaacgtcgacaccgaa
ctggtgagcatcgtgcgcgacgcggccaccccggtgacctcggtgatgatcaccgccacc
ggtgtggccgccagcatcggctgcaaggacgaccgcatccgtctcggcgaacgcgaactc
accggcccggccctcaacggcgccctggccgcctccgacgccatcctgctgaccttcgag
cagcctttgccggtgatcgagcaggtgatggcgcgggtgcggcggatgcggccgcggccg
ctgctgatggtgcatccggcgccgccggtggacgcgccgcagcatctgtatcagcatctg
ggggcggtcgattacctgatgggcgccacctgggagctggatgagatggtgccggaggtc
aaggccacctccggcgatcacatcgcccggcatctgcgcgcgctcggggtccgaaccgtc
tgtgtcatcgacgatttcgcgtgcacggtgcggtcggaggatctcgatctcgacgtcggc
cgcttccccgccgcgctcagcgattcccccggagcccgggccgcattcgccggggcattg
gcgtataggctcctgtcggcgcgccgcccggcgcaggaacaggactacgtctgggcgacc
gctgcgatggtggcgacccagtccttcggtgacatcccgggcgccatgccgctggcaggc
gagatcgaccgactcgtccggctcggcccggaagagcggtaa

DBGET integrated database retrieval system