KEGG   Nocardia cyriacigeorgica: NOCYR_2813Help
Entry
NOCYR_2813        CDS       T01756                                 

Gene name
choD
Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:ncy00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3113499..3115229
Genome map
AA seq 576 aa AA seqDB search
MAFDYDVLVIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADDEFAATSWRAREFLWAPRL
GCYGIQRLTLLKNTFIMSGAGVGGGSLVYANTLYEPPAAFYADKQWAAITDWRAELAPHY
DQAKRMLGVTTNPATTPSDRILREVAEELGVGDTYRQTPVGVLFGGAGSRPGQEVPDPFF
GGVGPARRTCTHCGECMTGCRHNAKNTLVKNYLYLAERAGAQVHPLTTVVDVRPRPEGGY
AVRTRRTGRWVRKAERVFTAEQVVFSAAALGTQKLLHQLRDRGSLPNISPRLGYLSRTNS
EELLSVRSRRRDADFTKGVAITSSIHPDAHTHIEPVRYGKGSNALALITTAMVGDDGVSP
RWRQWVRQLRRNRRDLLHMHNPHRWSEQMIGLLVMQSVDNSITTYTTRGVFGRKMTTKQG
EGEPNPTWIPVGHEVAERVAGKIDGFATGATSSIVNIPATGHFIGGCAIGDSPDTGVVDP
YHRLYGHPGLHVIDGSTISANLGVNPSLTITAQAERAIALWPNKGEPDQRPELGAPYRRL
APIAPVAPAVPATAPAALRLPIVEISGGQQPVELDN
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgattacgacgtgctggtgatcggttcgggtttcggtggcagtgtgtcggcg
ctgcggctgaccgagaagggctaccgggtcggcgtgctcgaggccggacgccgcttcgcc
gacgacgagttcgctgcgacgtcgtggcgggcgcgggagttcctgtgggcgccacggctg
ggctgctacggcatccagcggctgacgttgctgaagaacaccttcatcatgagcggcgcc
ggcgtcggcggcggatcgctggtctacgccaacaccctctacgagccgccggcggcgttc
tacgccgacaagcagtgggccgcgatcaccgactggcgcgccgagctggccccgcactac
gaccaggccaaacgcatgctcggcgtcaccaccaacccggccaccactcccagcgaccgg
atcctgcgtgaggtcgccgaggaactcggtgtcggcgatacctaccgccagacgccggtc
ggggtgctgttcggcggtgccgggtcgcgcccgggccaggaggtgcccgacccgttcttc
ggcggcgtcggcccggcccggcgcacctgcacccactgcggcgaatgcatgaccggctgc
cgccacaacgccaagaacaccctggtcaagaactacctgtatctggccgagcgggcgggc
gcgcaggtacatccgctgaccaccgtggtggatgtgcggccgcgacccgagggcggttac
gcggtgcgcacccgccgcacgggccgctgggtccgcaaggccgagcgggtgttcaccgcc
gaacaggtggtgttctccgcggccgcgctcggcacccagaaactgctgcaccagctgcgc
gaccgcggttcgctgccgaacatctcgccgcggctgggatatctgtcgcgcaccaactcc
gaggagctgctgtcggtgcgcagccgccgccgcgacgccgatttcaccaagggtgtggcc
atcacttcctccatccaccccgacgcgcacacccacatcgagccggtgcgctacggcaag
ggcagcaacgcgctggcgttgatcaccaccgcgatggtcggcgacgacggggtgagcccg
cgatggcggcaatgggtgcgccagctgcgccgcaaccgccgcgacctgctgcacatgcac
aatccgcaccgctggtccgagcagatgatcggactgctggtgatgcagtcggtggacaac
tccatcaccacctacaccacccgcggtgtgttcggccgcaagatgaccaccaaacagggt
gagggcgaaccgaatccgacctggatcccggtcggccacgaggtcgccgagcgggtcgcc
ggcaagatcgacggcttcgccaccggcgccaccagcagcatcgtcaatatcccggcgacc
gggcatttcatcggcggctgcgccatcggcgactcccccgacaccggcgtcgtcgacccc
taccaccgcctctacggtcatcccggcctgcacgtcatcgacggctctaccatctcggcc
aacctcggggtcaacccgtcgctgaccatcaccgcccaagccgaacgcgcgatcgccctg
tggcccaacaagggtgagcccgaccagcgacccgaactcggcgcgccgtaccggcggctg
gctccgatcgcaccggtcgccccggcggtaccggccaccgcgccggctgcgttgcggttg
ccgatcgtcgagatttccggcgggcagcagccggtcgagctcgacaactga

DBGET integrated database retrieval system