KEGG   Nocardia cyriacigeorgica: NOCYR_2925Help
Entry
NOCYR_2925        CDS       T01756                                 

Definition
Zinc-binding alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ncy01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ncy00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ncy00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:ncy00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ncy00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ncy00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3254544..3255095
Genome map
AA seq 183 aa AA seqDB search
MCAGIIGYHALLRAELPVEGVLGIYGFGGSAHLTAQIAIARGARVHVMTRGEAARELAAA
LGAASVQGQADAPPEPLDSAILFAPAGELVPPALEALDSGGTLALAGIHMSDIPPLNYQR
HLFRERQLRSVTSNTRAQALEFLSFAGRHHLRVSIHRYTLDHADRALSDLAHGRFDGAAV
LTA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgcgggcatcatcggctatcacgccctgctgcgtgcggaactgccggtcgaaggc
gttctgggtatctatggtttcggcggaagcgcgcacctgacagcacaaatcgcgatcgct
cgcggtgcacgcgtgcatgtgatgacacggggcgaggcggctcgtgagctggccgcggcc
ctgggggccgcctcagtacaaggccaggccgacgcaccgccggagccactggactcggcg
atcctgttcgcgcccgccggtgagctggttccgcccgcactcgaggcgttggacagcggg
ggcactcttgccttggccggcatccacatgtccgatattccgcctttgaactaccagcgc
cacctgttccgggaacgccagctgcgcagcgtcacctccaacacccgggcccaggccctg
gagttcctttccttcgccggccgtcatcacttgcgcgtatcgatccatcgctacacgctc
gaccacgccgatcgagcgctctccgatctcgcccacggacgcttcgacggcgccgccgtg
ctcactgcctga

DBGET integrated database retrieval system