KEGG   Nocardia cyriacigeorgica: NOCYR_2925Help
Entry
NOCYR_2925        CDS       T01756                                 

Definition
Zinc-binding alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NOCYR_2925
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOCYR_2925
  Lipid metabolism
   00071 Fatty acid degradation
    NOCYR_2925
  Amino acid metabolism
   00350 Tyrosine metabolism
    NOCYR_2925
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NOCYR_2925
   00626 Naphthalene degradation
    NOCYR_2925
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NOCYR_2925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3254544..3255095
Genome map
AA seq 183 aa AA seqDB search
MCAGIIGYHALLRAELPVEGVLGIYGFGGSAHLTAQIAIARGARVHVMTRGEAARELAAA
LGAASVQGQADAPPEPLDSAILFAPAGELVPPALEALDSGGTLALAGIHMSDIPPLNYQR
HLFRERQLRSVTSNTRAQALEFLSFAGRHHLRVSIHRYTLDHADRALSDLAHGRFDGAAV
LTA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgtgcgcgggcatcatcggctatcacgccctgctgcgtgcggaactgccggtcgaaggc
gttctgggtatctatggtttcggcggaagcgcgcacctgacagcacaaatcgcgatcgct
cgcggtgcacgcgtgcatgtgatgacacggggcgaggcggctcgtgagctggccgcggcc
ctgggggccgcctcagtacaaggccaggccgacgcaccgccggagccactggactcggcg
atcctgttcgcgcccgccggtgagctggttccgcccgcactcgaggcgttggacagcggg
ggcactcttgccttggccggcatccacatgtccgatattccgcctttgaactaccagcgc
cacctgttccgggaacgccagctgcgcagcgtcacctccaacacccgggcccaggccctg
gagttcctttccttcgccggccgtcatcacttgcgcgtatcgatccatcgctacacgctc
gaccacgccgatcgagcgctctccgatctcgcccacggacgcttcgacggcgccgccgtg
ctcactgcctga

DBGET integrated database retrieval system