KEGG   Nocardia cyriacigeorgica: NOCYR_3004Help
Entry
NOCYR_3004        CDS       T01756                                 

Definition
(GenBank) Short chain enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00071  Fatty acid degradation
ncy00280  Valine, leucine and isoleucine degradation
ncy00281  Geraniol degradation
ncy00310  Lysine degradation
ncy00360  Phenylalanine metabolism
ncy00362  Benzoate degradation
ncy00380  Tryptophan metabolism
ncy00410  beta-Alanine metabolism
ncy00627  Aminobenzoate degradation
ncy00640  Propanoate metabolism
ncy00650  Butanoate metabolism
ncy00903  Limonene and pinene degradation
ncy00930  Caprolactam degradation
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01212  Fatty acid metabolism
Module
ncy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NOCYR_3004
   00650 Butanoate metabolism
    NOCYR_3004
  Lipid metabolism
   00071 Fatty acid degradation
    NOCYR_3004
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOCYR_3004
   00310 Lysine degradation
    NOCYR_3004
   00360 Phenylalanine metabolism
    NOCYR_3004
   00380 Tryptophan metabolism
    NOCYR_3004
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NOCYR_3004
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NOCYR_3004
   00281 Geraniol degradation
    NOCYR_3004
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOCYR_3004
   00627 Aminobenzoate degradation
    NOCYR_3004
   00930 Caprolactam degradation
    NOCYR_3004
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     NOCYR_3004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: CCF63771
UniProt: H6RBD2
Position
complement(3356642..3357472)
Genome map
AA seq 276 aa AA seqDB search
MTVDSSSTDRVLVRKKGPVTIVSINRPEVRNAVNRATAEDLAAAFREFDRDPDAAVAILT
GEGGTFCAGADLKAVAAGDPNRFASDGDAPMGVSRMRLSKPVIAALSGHAVAGGLELALW
ADLRVADENTVLGVFCRRWGVPLIDGGTVRLPRVIGLGHAMDLILTGRPVSAHEAQGMGL
VNRVAPAGRSLATAVQLAEQLAAFPQTCMRQDRLSALEQEGLGETEALANEYEHGVVSIS
TDTLAGATRFAGGAGRHGSFTDLGNPEDAPERSTQS
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggattcgagcagtaccgaccgggtgctggtgcgcaagaaggggccggtcacg
atcgtcagcatcaaccgtcccgaggtccgcaatgcggtcaacagggccaccgccgaggac
ctggcagcggcgttccgcgagttcgaccgcgaccccgacgccgccgtggcgatcctgacc
ggtgaaggcggaacattttgcgccggagccgatctgaaggcggtcgccgccggtgacccc
aaccgcttcgcctccgacggggacgccccgatgggggtgtcgcggatgcgtctgtcgaaa
ccggtgatcgcggcgctgagcgggcacgcggtcgcgggcggactggagctggcgctgtgg
gccgacctgcgcgtcgccgacgagaacacggtgctcggcgtgttctgccgccggtggggc
gtgccgctgatcgacggcggcaccgtccggctgccacgggtgatcggcctcggacatgcg
atggatctgatcctgaccggccgacccgtgagcgcgcacgaggcgcagggcatgggcctg
gtcaaccgcgtcgccccggcaggccggtcgctggccaccgcggtgcagttggccgaacag
ctcgccgccttcccacagacctgcatgcgccaggaccggctgtccgcgctggaacaggaa
ggtctcggcgagaccgaggcgctggccaatgaatacgagcacggtgtcgtctccatctcc
accgacacactcgccggcgctacccgcttcgccggcggtgccggacgacacggctccttc
accgacctcggcaaccccgaggatgcacccgaaaggtccacccagtcatga

DBGET integrated database retrieval system