KEGG   Nocardia cyriacigeorgica: NOCYR_3177Help
Entry
NOCYR_3177        CDS       T01756                                 

Gene name
phoD
Definition
alkaline phosphatase D precursor (APaseD)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NOCYR_3177 (phoD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NOCYR_3177 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NOCYR_3177 (phoD)
Enzymes [BR:ncy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NOCYR_3177 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3534217..3535878)
Genome map
AA seq 553 aa AA seqDB search
MGLSRRQLLRFGGVASAAALAGSCAVSGARYRAPRWTGDPFTLGVASGEPTADGVVLWTR
LAPDPFAPDGLGGMPAHPVTVDYEIAHDEQFRQVVRRGSAVADRALGHSVHPEIGGLQPQ
RWYYYRFRAGSALSPVGRTRTAPRPGTGSRLRFAYASCQAWNDGHYTAYRHLAEEDLDLV
VHLGDYIYEYPLTGGRRGVRVPSPLRHEARDLAGYRLHYAWFKSEEPLRRAHAAFPWLVT
MDDHEVDDDWAADAVASTVDIDALRAVFLRRRAAAFQAMYEHQPLRLGQLPSGPNMRLHR
CFRFGDLAEITLLDTRQYRTRQACGGEIVTGCAPATNVDRTILGGAQRQWLLNGFAQSPA
RWQILGNQVVMGRTDHDPGPEVAISTDAWDGYASERAAILGAAADRSVRNLVVLTGDRHE
NYAADLRRDVADSESAVVAAEFTGTSITSGGDGVDLPGRGRDLLAANPDLKFYNAQRGYV
RVEVDHQLWRTDFRVVPFVERPGAPVHTRASFVVQDGVPGVVEASRWDRPATVEPTDRVE
HAAAPPLGSDDDR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgtcgcgtcggcagctgttgcggttcggtggcgtggcgtcggccgccgcgctg
gcgggaagttgcgcggtctccggcgcccggtatcgggctccgcgctggaccggcgatccc
ttcactctcggcgtcgcctccggtgagccgaccgccgacggggtggtgctgtggactcgg
ctggcgccggacccgttcgctcccgatggtctcggcggcatgcccgcccacccggtgacc
gtcgactatgaaatcgcccatgacgagcagttccggcaggtggtgcgccgcggctcggcg
gtggccgatcgagcgctgggccacagcgtgcatcccgagatcggcgggctgcaaccgcag
cggtggtactactaccggttccgggcgggttcggcgctgtcgccggtgggccgcacccgc
accgcaccgcggcccggtacgggttcgcgcctgcgcttcgcctacgcctcctgtcaggcc
tggaacgacggccattacaccgcctaccggcatctggccgaggaagacctcgatctggtg
gtgcatttgggcgactacatctacgaatatccgctgaccggcggccgtcgcggcgtgcgg
gtgccctcgccgctgcgccatgaagcccgcgacctggccggctaccgactgcactacgcg
tggttcaaatccgaggagccgttgcgccgggcgcatgcggcgttcccgtggctggtgaca
atggacgatcacgaggtcgacgacgactgggccgccgacgccgtcgcctcgaccgtcgat
atcgacgccctgcgcgctgtgttcctgcgccgtcgggctgctgccttccaagcgatgtac
gaacaccagccgctgcgcctcgggcagttgccgtcgggcccgaatatgcgcctgcatcgc
tgcttccggttcggcgacctcgccgagatcaccctgctcgacacccgccagtaccgcacc
cggcaggcctgcggcggcgagatcgtcaccggatgcgcgccggccacgaatgtggatcgc
accattctcggtggcgcgcaacgacagtggttgctcaacggtttcgcgcagtcgcccgcg
cgctggcagatcctcggcaaccaggtggtgatgggccgcaccgaccacgatcccggcccg
gaggtggcgatctccaccgacgcctgggacgggtacgcgagcgaacgtgccgcgatcctc
ggtgccgccgccgaccggtcggtgcgcaatctcgtggtgctcaccggcgaccggcacgag
aactacgccgccgacctgcgccgcgatgtcgccgacagcgaatccgcagtggtggcggcc
gaattcaccggcacctcgatcaccagcggcggcgacggcgtcgacctgcccggccgcgga
cgggacctgctggcggccaatccggatctgaagttctacaacgcccagcgcggctacgtg
cgggtggaggtcgatcaccagttgtggcgcaccgatttccgggtggtgccgtttgtcgag
cggcccggcgcgccggttcacacccgagcgagtttcgtcgtccaggacggtgtgcccggt
gtggtggaggcgtcccggtgggatcggcccgcgaccgtggagcccaccgatcgcgtcgag
cacgccgccgcaccgccgctcggctccgacgacgatcggtga

DBGET integrated database retrieval system