KEGG   Nocardia cyriacigeorgica: NOCYR_3475Help
Entry
NOCYR_3475        CDS       T01756                                 

Gene name
tpiA
Definition
(GenBank) tpiA Triosephosphate isomerase (TIM) (Triose-phosphate isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00010  Glycolysis / Gluconeogenesis
ncy00051  Fructose and mannose metabolism
ncy00562  Inositol phosphate metabolism
ncy00710  Carbon fixation in photosynthetic organisms
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
ncy01130  Biosynthesis of antibiotics
ncy01200  Carbon metabolism
ncy01230  Biosynthesis of amino acids
Module
ncy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ncy_M00002  Glycolysis, core module involving three-carbon compounds
ncy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NOCYR_3475 (tpiA)
   00051 Fructose and mannose metabolism
    NOCYR_3475 (tpiA)
   00562 Inositol phosphate metabolism
    NOCYR_3475 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NOCYR_3475 (tpiA)
Enzymes [BR:ncy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NOCYR_3475 (tpiA)
Exosome [BR:ncy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NOCYR_3475 (tpiA)
  Exosomal proteins of bladder cancer cells
   NOCYR_3475 (tpiA)
  Exosomal proteins of melanoma cells
   NOCYR_3475 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM TMP-TENI
Motif
Other DBs
NCBI-ProteinID: CCF64239
UniProt: H6R159
Position
complement(3842003..3842788)
Genome map
AA seq 261 aa AA seqDB search
MARKPLIAGNWKMNLNHLEAIALVQKIAFALPDKYFDKVDVTVIPPFTDIRSVQTLIEGD
KLRITFGAQDVSVHDEGAYTGEISASMLAKLGCSFVVVGHSERRQYHNEDDAIVLAKAKQ
ALKHGITPIVCIGEGLNVREAKTHVEYNLEQLRGSLKGLTAEEISKIVIAYEPVWAIGTG
KVATPADAQEVCGAIRGELAELASPEVAASVRVLYGGSVNAKNVGELVSQTDIDGALVGG
ASLKGDEFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaagccgctcatcgcgggcaactggaagatgaacctcaaccacctcgaggcc
atcgccctggtgcagaagatcgcgttcgccctgccggacaagtatttcgacaaggtcgac
gtcaccgtcatcccgccgttcaccgatatccgcagcgtgcagaccctgatcgagggcgac
aagctgcgcatcaccttcggcgcccaggatgtgtccgtgcacgacgaaggcgcctacacc
ggtgagatcagcgcgtccatgctggccaagctcgggtgcagcttcgtggtggtcgggcat
tcggaacgtcgccagtaccacaacgaggacgacgcgatcgtgctcgccaaggccaagcag
gcgctgaagcacgggatcaccccgatcgtgtgcatcggtgagggtcttaatgtccgcgag
gcgaagacccacgtcgagtacaacctcgagcagctgcgtggttcgctcaaaggcctgacg
gccgaggagatctcgaagatcgtcatcgcctacgagccggtgtgggccatcggcaccggc
aaggtcgccactcccgccgacgcgcaggaggtgtgcggcgccatccgcggcgagctcgcc
gaactggcctcgcccgaggtggcggcgtcggtgcgggtgctctacggcggttcggtcaat
gccaagaacgtcggcgaactggtctcccagaccgatatcgacggcgctctggtcggcggt
gcgtcgctcaagggtgacgagttcgccaccctgtcggcgatcgccgcgggcggcccgctg
ccctga

DBGET integrated database retrieval system