KEGG   Nocardia cyriacigeorgica: NOCYR_3504Help
Entry
NOCYR_3504        CDS       T01756                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ncy00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3873619..3874191)
Genome map
AA seq 190 aa AA seqDB search
MTKGRLVVLVGPSAVGKSTVVRCVRERLPHLVFSVSATTRAPRPGEVDGRDYRFVSREEF
DAMIEAGELLEWADIHGGLQRSGTPAAPVRAALSEGLPVLVEVDLEGARSVRKAMPEALL
VFLAPPSWDELVSRLRSRGTESPEVIERRLETARTELAACDEFDIVIVNDEVTSACEQLV
SLFVSTNSSS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagggtcggctggtcgttctggtcggcccctcggccgtgggcaagtccaccgtg
gtgcgctgcgttcgtgaacgcctaccgcacctggtgttcagcgtgtcggccacaacccgg
gccccacggcccggggaggtcgacggccgggactaccggttcgtcagccgcgaggaattc
gacgcgatgatcgaggccggggaactgctcgaatgggccgatatccacggcggactgcaa
cggtcgggtaccccggctgcgccggtccgcgcggccttgtccgagggcctgccggtgctg
gtggaggtcgacctggaaggcgcgcgctcggtccgcaaggcgatgcccgaggcgctgctg
gtgttcctggccccgccgagctgggacgaactggtctcccggctacgctcgcgcggcacc
gaatcgccggaggtcatcgagcgcaggctggagaccgcacgcaccgaactggccgcctgt
gacgagttcgacatcgtgatcgtgaacgacgaggtgaccagcgcctgcgagcagttggta
tcgttgttcgttagcacaaattcgagttcgtga

DBGET integrated database retrieval system