KEGG   Nocardia cyriacigeorgica: NOCYR_3631Help
Entry
NOCYR_3631        CDS       T01756                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NOCYR_3631
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     NOCYR_3631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4013301..4014644)
Genome map
AA seq 447 aa AA seqDB search
MRIAVAGGGISGVVSAYRLRGLLGPDAEIIVIERGERLGGILYTGEINGDPVDLGAEAFV
GRRPEVIELLSELGLDDQLVRPAGLRPLIWSAGRTHALPARTLMGIPSDAESLRGLVSEQ
TLEWVATEPERPFSWRPGSDIDVHSLVTDRFGAEVADRSVDPLLGGVYAGSSRSIGVRAA
LPTLAAALDKGAPNLTAAVTAALPPPSDAPVFGGIRDGYRVLLEALAERSGAKFVTGEAS
ELARTATGWRLDPLGEVDAVILATPAPVTARLLADEAPAASSALAGIELSSSAVVALALP
RDTPLPQNSGILVATGEPLSAKAFTLSSRKWPHLAARDIALVRASFGKFGDDAVLAWPDG
ELVAAAVADLSTVTGVPIAPLSATVQRWPGALAQYAPGHTTRIAEIESAAAEFDTLAITG
AYLHGVGVPACVASATSAAQHIAAALS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcgcggtcgccggcggtggcatcagtggtgtggtctcggcgtatcggctgcgt
ggcctgctcgggccggacgccgagatcatcgtgatcgagcggggggagcggctcgggggg
atcctctacaccggcgagatcaacggagacccagtggatctgggcgcggaggcctttgtc
gggcgacggcccgaggtgatcgagctgctgtcggaactcggactcgacgatcaattggtg
cggcccgccggattgcgtccgctgatctggtccgcggggcgcacccacgcgttgccggcg
cggacgctgatgggcatcccgtccgatgccgaatcactgcgcgggttggtgtcggagcag
accctcgagtgggtcgccaccgaacccgaacggccgttcagctggcggccgggttcggat
atcgacgtgcacagcctggtcaccgaccgcttcggcgccgaagtcgccgatcgcagcgtg
gacccgctgctgggcggggtgtatgcgggcagctcacgatccatcggcgtgcgcgcggcg
ctgcccaccctcgccgccgccctggacaagggcgcacccaacttgaccgccgcggtcacc
gccgccctgccgccgccgtcggacgcgccggtcttcggtggtatccgcgatgggtaccgg
gtgctgctcgaagcgctcgccgaacgctccggtgcgaagttcgtgaccggcgaagcgagc
gaactcgcccggaccgccacgggatggcggctcgacccactgggtgaggtcgacgccgtc
atcctcgccacccccgcgcccgtgacggcccgcctgctcgcggacgaagcgcccgcagcg
tcgtccgccctcgccgggatcgagctgtcctcctccgcggtggtcgcgctcgccctgccg
cgtgacaccccactgccgcagaactccggcatcctcgtcgccaccggagaaccgttgagc
gccaaggcgttcacgctgtcgagccgcaaatggccgcaccttgccgcccgcgacatcgca
ctcgtgcgcgcctccttcggcaagttcggcgacgacgcggtgctggcctggccggacggt
gaactcgtcgccgccgccgtcgccgatctgtccaccgtcaccggcgtccccatcgcaccg
ctgtcggccacggtgcaacgctggcccggagccctcgcgcaatacgctccaggccacacc
acccgcatcgccgagatcgagtccgccgcggccgaattcgacactctggcgatcaccggc
gcctacctgcacggcgtcggcgtgcccgcctgcgtggcgtcggcgacctccgccgctcag
cacatcgccgcagcgttgagctga

DBGET integrated database retrieval system