KEGG   Nocardia cyriacigeorgica: NOCYR_3805Help
Entry
NOCYR_3805        CDS       T01756                                 

Definition
putative magnesium chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NOCYR_3805
Enzymes [BR:ncy01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     NOCYR_3805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4194195..4196213)
Genome map
AA seq 672 aa AA seqDB search
MSHVETAESSAPRSPGGTGAGDESGFPFSAVVGQERLQLALILCAVHPGIGGVLVRGEKG
TAKSTVVRALAQLLPPVVDETGARPARLVELPVGATEDRVVGSLDLERVLRDGEQAFRPG
LLAAAHHGVLYVDEVNLLHDHLVDVLLDAAAMGRVHIERDGVSHSHPARFVLVGTMNPEE
GELRPQLLDRFGLTVDVAASRDVDVRMAVVRRRLDYEADPSGFAARYAAADREVAERILT
ARDRLPEVALDDVELRRIAALCAAFDVDGMRADLVVARTATAHAAWRGSETVTEDDVRVA
AELALPHRRRRDPFDEPGISEDQLDEAMREAAEEADRTPDPSPEPEAGNDGSADHAPDSD
PADGPDDDPDGPPDPSGGGQDSPNGREGGQAKESRTGTPATTSAKPPRWEVPGVGEGAPG
RRSRAQTRQGRMVRPDTDTTGGLHLLGTVFAAAPHQHARGRASGPLKLASEDLRGAYREG
REGNLVVFVVDASGSMAARDRLSAVTGAVVALLRDAYQRRDKVAVITVRGAEAELVLPPT
SSVDIAVRRLAGMRTGGKTPLATGLLKAREVVLRERVRDPRRRPMLVLLTDGRATGGTDP
VIRARAAARLLAAEAVTAMVVDCERGMIRLGLAAELARELRGECVRLGELTGDAVAGVVR
ESAWGSGSTRAA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcatgtcgaaaccgcagagtcgtccgcacctcgctcgccgggcgggaccggtgcc
ggtgacgagtccggcttcccgttctccgcggtggtcgggcaggagcggctgcaactggcg
ctgatcctgtgcgcggtgcaccccggtatcggcggggtgctggtgcgcggggagaagggc
accgccaaatcgacggtggtgcgcgcgctggcgcagctgctgccgccggtcgtggatgag
accggcgcgcgcccggcccggctggtggaactgccggttggcgccaccgaggaccgggtg
gtcggctccctcgatctggagcgtgtgctgcgcgacggtgagcaggccttccgccccggc
ctgctggcggccgcccatcacggcgtgctctacgtcgacgaggtgaacctgctgcacgac
cacctggtggacgtactgctcgacgccgccgccatggggcgcgtgcatatcgaacgcgac
ggcgtctcgcattcgcatccggcgcgcttcgtgctggtcggcaccatgaacccggaagag
ggcgaactgcggccgcagctgctggaccgcttcggcctcaccgtcgacgtggccgcttcc
cgcgacgtcgacgtgcggatggccgtggtgcgccggcgcctggactacgaggccgacccg
tccggcttcgccgcccgctacgccgccgccgaccgcgaggtcgccgaacgcattctcacc
gcccgggaccggctgcccgaggtcgcgctcgacgatgtggagctgcgccggatcgcggcg
ctgtgcgcggccttcgacgtggacgggatgcgcgcggacctggtggtcgcgcgcaccgcc
accgcgcacgccgcctggcgcggcagcgagaccgtcaccgaggacgatgtgcgggtcgct
gccgaactcgcgctgccgcaccggcgtcggcgtgacccgttcgacgagccggggatcagc
gaggaccagctcgacgaggccatgcgtgaggcggccgaagaagccgatcggacgccggac
ccttcacccgaacccgaggccggcaacgacggttccgccgaccatgctcccgattccgat
ccggccgacggacccgacgacgatcccgatggtccgccggatccctctggcggcggccag
gattcgccgaacggccgcgagggtgggcaggcgaaggaaagccgcaccggcaccccggcg
acgacgtccgcgaaaccaccgcgctgggaggtgcccggcgtcggcgaaggtgccccggga
cgtcgctcgcgcgcacagaccaggcagggccgcatggtccgtccggataccgacaccacc
ggtgggctgcatctgctcggtaccgtattcgccgccgcgccgcatcagcatgcgcgcggc
cgggcgagcgggccgctgaaattggcgtcggaggatctgcggggcgcctatcgcgaaggg
cgcgaaggcaatctggtggtcttcgtggtcgatgcctccgggtccatggcggcacgcgat
cggctctcggcggtcaccggcgcggtggtcgcgctgctgcgcgatgcgtatcagcggcgg
gacaaggtcgcggtgatcaccgtgcgcggcgccgaggcggagctggtgctgccgccgacg
tcatcggtcgatatcgcggtgcggcggctggccggaatgcggaccggggggaagaccccg
ctcgccaccggcctgctgaaggcgcgcgaggtggtgcttcgggagcgggttcgcgatccg
cgccgtcgcccgatgctggtgctgctcaccgacggtcgcgccaccggcggcaccgacccg
gtgatccgcgcccgcgccgcggcgcggttgctcgcggcggaggcggtgacggcgatggtc
gtcgactgtgaacgcggcatgatccggctggggctcgccgccgagctggcacgggaactg
cgtggtgagtgtgtgcggctgggtgagctgaccggggacgcggtggccggtgtggtgcgc
gagtcggcgtggggttcggggtctacccgggcggcgtga

DBGET integrated database retrieval system