KEGG   Nocardia cyriacigeorgica: NOCYR_3866Help
Entry
NOCYR_3866        CDS       T01756                                 

Definition
putative acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ncy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ncy00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ncy00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ncy00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:ncy00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4254490..4256115
Genome map
AA seq 541 aa AA seqDB search
MGIDPNARVRELLECYDRADASAAWLLCDRHPADAVAFTVIDSDLSSTDLTYGQLRAKSE
RFAAALARLGVEPGDRVATLMAKSEDLVVALLGIWRRGAVHVPLFTAFAPPAIAFRLAAS
GASIVITDPDQASKLAPGDDIPADPPWRVIVTGDDPAPDKLRMRDLMTADAAVEPAVAVG
GDGLLVQLFTSGTTGTPKGVPIPVRALASFHAYQEFALDVRPDDVFWNAADPGWAYGLYY
AILGPLASGIRSLLLHAGFSPALTWQVMDTFGVTNFAAAPTVYRALRADSATAPKLRLRR
ASSAGEPLTPEVVAWSADTLGVAVRDHYGQTEHGMVICNAWHDDLNTEAPAGSMGRSLPG
WACAVLADDADVEAPTGQLGRIAIDTERSPLLWFLGYLDAPERTAQRYTPDGRWYLTGDA
GSQDADGFFHFSARDDDVIIMAGYRIGPFEVESVLVMHEDVAEAAVVGLPDELRGEVLEA
FVVLREGVTGSAELEAELQTLVKKKFAAHAYPRRVHFVPSLPKTPSGKVQRFLLRQQEVR
S
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgacccgaacgcgcgggtgcgcgagctgctggagtgttatgaccgcgccgat
gcgagcgcggcctggctgctgtgtgaccggcatccggccgatgccgtcgccttcaccgtc
atcgacagcgatctgtcgtcgacggatctgacctacggccagttgcgcgcgaagtccgaa
cgtttcgcggcggcattggcgcggctcggagtcgaaccgggtgaccgggtcgccacgctg
atggcgaagtccgaagacctggtggtggccctgctcgggatctggcggcgcggtgcggtg
catgttccgctgttcaccgcgttcgcgccgccggcgatcgcgttccggctggccgccagc
ggcgcctcgatcgtgatcaccgatccggatcaggcgagcaagctggcgccgggcgacgat
atccccgccgatccgccgtggcgcgtcatcgtcaccggtgacgatccggcgccggacaag
ctgcggatgcgcgatctgatgaccgccgacgcggcggtggagcccgccgtggcggtcggc
ggcgacggcctgctggtccagttgttcaccagcggcaccaccggcacgccgaagggtgtg
ccgatcccggtgcgggcactggcgtcgttccacgcctatcaagaattcgcgctcgacgtg
cgtccggacgacgtgttctggaacgccgccgacccgggctgggcctacggcctctactac
gcgatcctcggtccgctggcgagcggtatccgcagcctgctgctgcacgcgggcttctcc
cccgcgctgacctggcaggtcatggacaccttcggagtcaccaatttcgcggccgcgccc
acggtctatcgcgcgctgcgcgccgacagcgcgacggcaccgaagctgcggctgcgccgg
gcgtcgtcggcgggtgagccgctgacgcccgaggtggtggcctggtccgcggacaccctc
ggcgtcgcggtgcgcgaccactacggccagaccgagcacggcatggtgatctgcaatgcc
tggcacgacgacctgaacaccgaggcacccgcgggctcgatgggccgttcgctgcccggc
tgggcgtgtgcggtgctcgccgacgacgccgacgtcgaggcgccgaccgggcaactcggc
cgcatcgccatcgataccgaacgcagcccgctgctgtggttcctcggctacctcgacgcg
cccgagcgcaccgcgcagcgctacacccccgatgggcgctggtacctcaccggtgacgcg
ggctcgcaggacgccgacggtttcttccacttctccgcccgcgacgacgacgtcatcatc
atggccggttaccgaatcggcccgttcgaggtggaaagcgtgctggtcatgcacgaagac
gtcgccgaggcggccgtggtcggcctgcccgacgaactgcgcggtgaggtgctcgaagcg
ttcgttgtgctgcgcgagggcgtcaccggcagcgccgaactggaggccgaactccagacg
ctggtgaagaagaagttcgccgcgcacgcctatccgcggcgagtgcatttcgtgccgagc
ctgccgaaaacacccagcggcaaggtgcaacggttcctgctgcgtcagcaggaggtgcgg
tcatga

DBGET integrated database retrieval system