KEGG   Nocardia cyriacigeorgica: NOCYR_3994Help
Entry
NOCYR_3994        CDS       T01756                                 

Definition
putative succinate dehydrogenase
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    NOCYR_3994
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     NOCYR_3994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4399721..4401199)
Genome map
AA seq 492 aa AA seqDB search
MSARVPVTPIAAADIAAYDHETDVLVVGYGCAGAAAALDADAAGAEVILLERQSGGGGSS
ALSGGEMYLGGGTPIQRACGFDDTAEDMEKFLLAALGPDADQEKVGLYCRDSVAHYEWLT
GHGVPFKPSLWDSPTWVPPTDDGLMWMGENAYPFNTIATPAPRGHRVTSDGFGGKVLMAV
LSEAVGRTGIRVHTDTAALRLIVDGNRVVGVAARHFGDTVTYRARRGVVLTTGGFADNAE
MVAQHAPQLVGLGVNSDGGDDGRGIVIAQAAGAAVKHMSAGQVGISLVPGMMVRGMIVNE
VGQRFINEDVYPGLVGQAALFKHNLRVWVILDEQAYEEVPEDERWGVRPHFVAESLAELE
QEIGMPEGALHTTVGEYNRHAEHGADPYFHKSARWLRPLRSPFAAIDVRRGMAPPEYGDG
GTAGGGAEVFTIGGLHTSVDGHVLDLDGAPIPGLFAAGRATSGLHSWGYISGTSLGDGTF
FGRRAGRAAARR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccgcgtccccgtcaccccgatcgccgccgccgacatcgcggcctacgaccac
gaaaccgatgtgctggtggtcggttacggctgcgcgggagccgccgcggccctcgacgcc
gacgcggcgggggccgaggtgattctgctggaacggcagagcggtggcggcggctcttcg
gcgctgtcgggcggggagatgtatctcggcggcggcacccccatccagcgggcctgcggg
ttcgacgacaccgccgaggatatggagaagttcctgctcgccgccctcggaccggacgcc
gaccaggagaaggtcggtctctactgccgcgacagtgtcgcgcattacgagtggctgacc
gggcacggcgtgccattcaagccctccctgtgggattcgccgacctgggtgccgcccacc
gacgacggtctgatgtggatgggggagaacgcctatccgttcaacacgatcgccacgccc
gccccgcgcgggcatcgcgtcacctcggacggtttcggcggcaaggtactcatggcggtg
ctgagtgaggccgtggggcgcaccggcatccgggtgcacaccgacaccgccgcgctgcgg
ctgatcgtcgacggcaatcgcgtggtcggtgtcgccgcacggcatttcggcgacaccgtg
acctaccgggcgcgccgcggcgtcgtcctcaccaccggcgggttcgccgacaatgccgag
atggtcgcccagcatgcgccgcagctggtggggctcggcgtcaacagtgacggcggcgac
gacggccgcggcatcgtcatcgcgcaggccgccggcgcggcggtcaaacacatgtccgcc
ggtcaggtcggtatttcgctggtgccggggatgatggtgcgcggcatgatcgtcaacgag
gtggggcagcggttcatcaacgaggacgtctaccccggcctggtcgggcaggcggcgttg
ttcaagcacaacctgcgggtgtgggtgatcctcgacgaacaggcctacgaggaagtgccc
gaggacgaacgctggggtgtgcgaccacatttcgtcgccgaatccctcgccgaactcgaa
caggagatcggcatgcccgaaggcgccctgcacacaaccgtcggcgaatacaaccggcac
gccgaacacggcgccgacccctatttccacaagtcggcgcgctggctgcggccgctgcgc
tcgccgttcgccgcgatcgacgtgcgccgcggcatggccccgcccgagtacggcgacggc
gggacggcgggcggcggcgccgaggtcttcaccatcggcggcctgcacaccagcgtcgac
ggacacgtcctcgacctcgacggcgcaccgattccgggtctgttcgcggccggtcgcgcc
acttcgggcctgcactcctggggctacatcagcggcacctccctcggcgacggcaccttc
ttcggccgccgcgcgggccgggccgccgcgcgccgatag

DBGET integrated database retrieval system