KEGG   Nocardia cyriacigeorgica: NOCYR_4047Help
Entry
NOCYR_4047        CDS       T01756                                 

Definition
glycosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NOCYR_4047
Enzymes [BR:ncy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     NOCYR_4047
Glycosyltransferases [BR:ncy01003]
 Polysaccharide
  Storage polysaccharide
   NOCYR_4047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4459567..4460829
Genome map
AA seq 420 aa AA seqDB search
MKILMVSWEYPPVVVGGLGRHVHHLATELAAAGHEVVVLARRPTGTDPSTHPTHSYIADG
VLVVAVAEDPPFFDFGEDMLAWTLAMGHAMVRAGVALNKPGIGEGWTPDVVHAHDWLVAH
PAIALAEYYDVPLVSTIHATEAGRHSGWVSGKVNRQVHSVEWWLANESDALITCSTSMQD
EVERLYQPDRIPLTVIRNGIDVGAWTFRPRPPRSGPPRLLYVGRLEYEKGVQDAIAALPR
IRRAHPGTTLTVAGVGTQFEWLRERARVHRVARAVNFAGQLDHAELLGWLHGADAIVLPS
RYEPFGIVALEAAAAGTPLVTSTAGGLGEAVIDGVTGASFEPADVDGLVQAVRAVLDDPA
AAQERAYAARERLTADFAWDVVAAETAQVYQAAKRRVRTPLGRPVITMRPLPERDPSQPV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcttgatggtgtcgtgggagtacccgccggtcgtcgtcggcgggctgggccgg
cacgtccatcatctggccaccgagctcgctgccgcaggccacgaggtggtcgtgctggcg
cgccgccccaccggcaccgatccgtcgacccatcccacacactcctacatcgccgacggc
gtgctggtggtcgccgtcgccgaggacccgccgttcttcgatttcggcgaggacatgctg
gcgtggacgctggcgatgggccacgccatggtgcgcgcgggcgtggcgctgaacaagccg
ggtatcggcgagggctggacacccgatgtggtgcacgcccacgactggctggtggcccat
cccgccatcgcgctggccgagtactacgacgtgccgctggtgtcgaccattcacgccacc
gaggccggacgccacagcggctgggtctccggcaaggtgaaccgccaggtgcattcggtg
gagtggtggctggccaacgaatccgacgccctcatcacctgctcgacgtcgatgcaggac
gaggtggaacggctctaccagcccgaccgcatcccgctcaccgtcatccgcaacggcatc
gacgtcggcgcctggaccttccggccgcgcccgccccgcagcggcccgccgcggctgctg
tatgtgggcaggctggaatacgagaagggcgtgcaggatgcgatcgccgcgctgccgcgg
atccggcgcgcccatcccggcaccacgctcaccgtcgccggtgtgggcacccagttcgaa
tggttgcgcgagcgggcccgggtgcaccgggtggcgcgggcggtgaatttcgccggccag
ctcgaccacgccgaactgctcggctggctgcacggcgccgacgccatcgtgctgcccagc
cgctacgaaccgttcggcatcgtcgcactcgaggcggccgcggcggggactccgctggtc
acctccaccgccggtgggctcggcgaggccgtgatcgacggggtgaccggcgcgtcgttc
gaaccggccgacgtggacgggctcgtccaggccgtgcgcgcggtgctcgacgatccggcc
gccgcccaggaacgcgcctacgccgcccgcgagcggctgaccgccgatttcgcctgggat
gtggtggccgccgaaaccgcgcaggtgtatcaggccgccaagcgccgggtgcgcaccccg
ctcggccggccggtgatcaccatgcgcccgctacccgaacgcgatccgagccagccggtc
tga

DBGET integrated database retrieval system