KEGG   Nocardia cyriacigeorgica: NOCYR_4223Help
Entry
NOCYR_4223        CDS       T01756                                 

Gene name
glsA
Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00220  Arginine biosynthesis
ncy00250  Alanine, aspartate and glutamate metabolism
ncy00471  D-Glutamine and D-glutamate metabolism
ncy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NOCYR_4223 (glsA)
   00220 Arginine biosynthesis
    NOCYR_4223 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NOCYR_4223 (glsA)
Enzymes [BR:ncy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     NOCYR_4223 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CCF64982
UniProt: H6RAH0
Position
4643763..4644773
Genome map
AA seq 336 aa AA seqDB search
MDLDVEGIEQAVSTGALPGWDRVEKLVGAAYERYLPLRAGAVADYIPVLAEADPELFGIA
VAEVNGDLHTAGAADAQFSIQSIAKAFVYALVCDALGHEAVLDRVGVNNTGLAFNSVIAI
ELNDGHPMNPMVNAGALATTAMVPGATPAEQWERIRSGLSRFAGRPLDLDGAVYHSEMLT
NQRNKAIARLLESYGRIEIDPLEVVDVYTRQCSLRVDARDLAIMGATLADGGVNPVTHER
VVSAQVCRDTLAVLAATGMYERSGEWLFEIGLPAKSGVAGGIVAIAPGKGAIGTYSPRLD
SAGNSERGIRATAYLSRTLGLNIFASDVHDQRGATA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggacctggacgtcgagggaatcgagcaagccgtatcgaccggcgcgctgccgggctgg
gaccgggtggaaaagctggtcggggcggcctacgaacgctacctgccgttgcgggccgga
gccgtcgccgactacatcccggtcctcgccgaagccgaccccgagctgttcggcatcgcg
gtcgcggaggtcaacggcgatctgcacaccgcgggcgcggctgacgcccagttcagcatc
caatcgatcgccaaggcgttcgtctacgcgctggtctgcgacgcgctcggacacgaagcg
gtgctcgaccgggtcggggtgaacaacaccggcctggcattcaattcggtgatcgccatc
gaactcaacgacggccacccgatgaacccgatggtcaacgccggtgcgctggcgacgaca
gcgatggtgcccggcgccacccccgccgagcagtgggaacgcatccgctcggggctgtcc
cgattcgctggacgcccgctcgatctggacggcgcggtctaccactcggagatgctgacc
aatcagcgcaacaaggccatcgcccggctgctggaaagctacggccgcatcgagatcgac
ccgctcgaggtggtcgacgtctacacccggcagtgctcactccgggtcgacgcccgcgat
ctggcgatcatgggtgcgaccctggccgacggcggggtgaacccggtgacccacgaacgc
gtcgtctccgcgcaggtctgccgggacacactggcggtactggcggccacgggcatgtac
gagcggtccggcgagtggttgttcgagatcggtctgccggccaaatccggggtcgcgggc
ggcatcgtcgccatcgcgccgggtaagggcgccatcggcacctattcgccgcgcctggat
tcggcgggcaacagcgaacgaggcatccgcgcgaccgcctatctgtcgcgcacgctcggc
ctgaacatcttcgcgtccgacgtccacgatcagaggggtgctaccgcatga

DBGET integrated database retrieval system