KEGG   Nocardia cyriacigeorgica: NOCYR_4286Help
Entry
NOCYR_4286        CDS       T01756                                 

Definition
(GenBank) Conserved protein of unknown function; putative winged-DNA domain; putative uroporphyrinogen domain
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00860  Porphyrin and chlorophyll metabolism
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01120  Microbial metabolism in diverse environments
Module
ncy_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NOCYR_4286
Enzymes [BR:ncy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NOCYR_4286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CCF65044
UniProt: H6RBK2
Position
complement(4719191..4720411)
Genome map
AA seq 406 aa AA seqDB search
MTTPDAGASLAGFTVGVTAARRSEEFATLLTRRGATIMSAPAIRIIPLADDNELERVTRR
LVDDPPQITVATTGIGFRGWMEAAEGWGLAEQLRATLACTRVVARGPKAKGAIRAAELRE
EWSPASESSAEVLDHLLAEGVEGVRIAVQLHGATTEWEPVPDFCEVLRCAGADVVPVPVY
RWTPPADQGPMDQLIEAIVTSNLDCVTFTSAPAVASMLMRAKETGMIEGLLHALRGRVLA
ACVGPITAAPLEELGVPTSMPARARLGALARHVAEELPRRANRIHAAGHTISVRGGCVVV
DGVVRQLAPAPMSLMRSLARQPGRVVSREDLLAALPGGGDDTHAVETAIARLRAGLGTPK
AIQTVVKRGYRLALDPAECTDNNPRPVVPGVGTPTRAPRFAQAVTW
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcccgacgcgggcgcgtcgctcgcgggcttcacggtcggagtcacggccgcc
cggcgttccgaagagttcgccaccctgctcacccggcgcggcgcgaccatcatgtccgcg
cccgccatccgcatcatcccgctggccgacgacaacgaactggaacgggtcacccgccgg
ctcgtcgacgatccgccgcagatcaccgtcgccaccaccggtatcggtttccgcggctgg
atggaggccgccgaaggctggggcctggccgaacagctgcgcgccacgctggcgtgcacc
cgggtggtggcccgcggcccgaaggccaagggcgccatccgcgctgccgaactgcgcgag
gaatggtcgccggcgtcggagtcctcggccgaggtgctcgaccacctgctggccgaaggc
gtggaaggtgtgcgcatcgcggtgcagctgcacggcgcgaccaccgaatgggagccggtt
cccgacttctgcgaggtattgcgttgcgccggcgccgatgtggtgccggtgccggtgtat
cgctggaccccgcccgccgatcaaggcccgatggatcagctgatcgaggccatcgtcacc
tcgaacctggactgcgtcaccttcaccagcgcgcccgccgtggcgtcgatgttgatgcgc
gccaaggaaaccgggatgatcgagggcctgctgcacgccctgcgcgggcgggtgctggcc
gcctgtgtcggcccgatcaccgcggcgccgctggaggagctgggggtgccgacgtcgatg
cccgcgcgggcccggctcggtgcgctggcccggcacgtcgccgaggaactgccgcggcgc
gccaaccggattcacgcggccgggcacaccatcagtgtgcgcggcgggtgtgtggtggtc
gacggcgtcgtccgtcagctcgcgcccgcgccgatgtcgttgatgcgttcgctggcccgt
cagcccggccgcgtcgtgtcccgggaggatctgctggcggccctgcccggcggcggtgac
gacacccatgcggtggagacggcgatcgcccgtcttcgtgcgggtctgggcacgcccaag
gccattcagaccgtggtcaaacgcggctaccgattggcgctcgacccggccgaatgtacc
gacaacaacccacgtcccgtggtgcccggagtcggaacgccgacccgggcaccgcgcttt
gcccaggcggtcacgtggtga

DBGET integrated database retrieval system