KEGG   Nocardia cyriacigeorgica: NOCYR_4393Help
Entry
NOCYR_4393        CDS       T01756                                 

Definition
putative fumarate reductase flavoprotein subunit precursor (Flavocytochrome c) (FL cyt)
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    NOCYR_4393
Enzymes [BR:ncy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     NOCYR_4393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4838146..4839618
Genome map
AA seq 490 aa AA seqDB search
MAESTPTTVRPLPVTEVASWDHAADVVVAGYGIAGVCAAIEAARAGASVLILERTGGWGG
AAALAGGFIYLGGGTPLQRALGFDDTPENMAKFLLAALGPGADREKIVDYCDGSVEHYEW
LVANGVPFREAFWAEPGWEPPHDEGLMYTGGENAAPFNTIAEPAPRGHVPQMSDKRTGEK
GGGYMLMKPLAETAEKLGVGVEYDMRIQRLVVDGERVVGVIAKRYGKQVAIRADRGVVLA
TGSFAYQQQMIEGYAPRLIGRPAAAIEEHDGIGIRVAQALGAELAHMDATEVAFFGDPQL
LARGILVNGRGQRYIAEDTYPGRIGQATLIQQDNQAYLVIGESAYEQALTTETSTPFFRQ
PPTWAAESVAELESDMGLPAGALTSTVEVYNRHATKGADPLLGKKPEWVTPIEGPVAGFD
MRGFTAGFTLGGLRTDLDSRVLHVDGTPIAGLYAAGRCTSGICAGGYVSGASLGDGSFYG
RRAGIAAAKN
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatcgacaccgaccaccgtccgcccgctgccggtgacggaggtggcgagctgg
gatcacgcggccgacgtcgtcgtcgccgggtacgggatcgccggggtctgcgccgccatc
gaggccgcgcgggccggcgcgagcgtgttgatcctggaacgcaccggcggctggggcggt
gcggccgcgctggccggcggattcatctacctcggcggcggcacgcccctgcaacgggcg
ctcggcttcgacgacaccccggagaacatggcgaagttcctgctcgccgcgctcggtccg
ggcgcggatcgggagaagatcgtcgactactgcgacggcagcgtcgagcactatgaatgg
ctggtggccaacggtgtgccgttccgggaagcgttctgggccgaacccggctgggagccg
ccgcatgacgagggcctgatgtacaccggcggggagaacgcggccccgttcaacaccatc
gccgaacctgccccgcgcggccacgtgccgcagatgtccgataagcgcaccggcgagaag
ggcggcggctacatgctgatgaagccgctggccgagaccgccgaaaagctcggcgtcggc
gtcgaatacgacatgcggatccagcggctggtggtcgacggcgagcgggtcgtcggtgtg
atcgccaaacgctacggcaagcaggtcgcgatccgcgccgaccgcggtgtggtgctggct
accggtagcttcgcctaccagcagcagatgatcgaggggtacgcaccgcggttgatcgga
cggcccgccgccgccatcgaggagcacgacggcatcggcatccgggtcgcgcaggccctc
ggcgcggagctggcccatatggacgccaccgaggtggcgttcttcggcgatccgcagctg
ctcgcgcgcggcatcctcgtcaacggacgcggccagcgctacatcgcggaggacacctac
ccgggccgcatcggtcaggccacgttgatccagcaggacaaccaggcctatctcgtcatc
ggcgaatccgcctacgaacaggcgctgaccaccgagacctccacgccgttcttccggcag
ccgcccacctgggccgcggaatcggtcgccgaactcgaatccgatatggggctgcccgcc
ggggcgctgacctcgacggtggaggtatacaaccgccatgccaccaagggcgccgatccc
ctgctcggcaagaaaccggaatgggtgacgccgatcgagggcccggtcgcgggcttcgat
atgcgcggattcaccgcgggcttcaccctcggtgggctgcgcaccgacctggacagccgg
gtgctgcacgtcgacggcacgccgatcgccgggctgtacgcggccgggcgctgcacctcc
ggcatctgcgccggcggctatgtcagcggggcctcgctcggcgacggcagcttctacgga
cgccgcgcgggcatcgccgcggccaagaactga

DBGET integrated database retrieval system