KEGG   Nocardia cyriacigeorgica: NOCYR_4487Help
Entry
NOCYR_4487        CDS       T01756                                 

Gene name
dapE
Definition
(GenBank) N-succinyl-diaminopimelate deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00300  Lysine biosynthesis
ncy01100  Metabolic pathways
ncy01120  Microbial metabolism in diverse environments
ncy01230  Biosynthesis of amino acids
Module
ncy_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NOCYR_4487 (dapE)
Enzymes [BR:ncy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NOCYR_4487 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CCF65243
UniProt: H6RDJ2
Position
complement(4943106..4944206)
Genome map
AA seq 366 aa AA seqDB search
MTLDLRADPIALTAALVDIPSVSRDELAVTDAVEAALRTQTSGFEIVRDGNVVLARTDRG
LPTRVVLAGHLDTVPIADNVPSRMDVEDGEPVMYGCGTVDMKSGDAVFLHLAATIAEPAH
DLTLIFYDCEEIAAEFNGLARIERERPEWLDGDLAILGEPSGGWVEAGCQGTLRARLTTA
GTRAHSARAWLGDNAIHRLAPVLQRLSEYRAREVDIDGCVYREGLSAVRVAGGVAGNVVP
DAAEVDVNFRFAPDRSVAQATDHVREVFAGLELDFQVTDAAPGALPGLTAPAAKDLINRV
HAHGAAGVRAKYGWTDVSRFAARGVPAVNFGPGDPNLAHKRDERVPLAQITQVTAMLRSY
LTGASS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcgatctgcgcgccgacccgattgccctgactgccgccctcgtcgacatcccg
agtgtgtccagggacgagctggccgtcaccgacgcggtcgaggccgcgttgcgcacacag
accagcgggttcgagatcgtgcgcgacggcaacgtggtgctggcgcgcaccgatcgcggg
ctgccgacccgggtggtgctggccgggcacctggacacggtgccgatcgccgacaatgtg
ccgagccggatggacgtcgaggacggtgagccggtgatgtacggctgcggcaccgtggac
atgaaatccggcgatgcggtgttcctgcatctggccgccaccatcgccgaacccgcgcac
gatctgacgctgatcttctacgactgcgaggagatcgccgcggagttcaacggcctggcc
cggatcgaacgcgaacgcccggaatggctggacggcgatctggcgatcctcggcgaaccc
tccggcggctgggtcgaggccggctgccagggcaccctgcgggcccggctcaccaccgcg
ggcaccagggcgcattcggcacgagcctggctgggcgacaacgccattcatcggctggcg
ccggtcttgcagcggctgtcggagtaccgggcgcgggaggtcgatatcgacggctgcgtc
taccgcgagggactgtcggcggtgcgggtggccggcggggtggcgggcaatgtggtgccc
gatgccgccgaggtcgacgtcaatttccggttcgcgcccgaccgcagcgtcgcccaggcc
accgaccacgtccgcgaggtcttcgccggcctggagctcgacttccaggtcaccgacgcc
gcccccggcgccctgcccggcctcacggcacccgccgccaaggacttgatcaaccgggtg
cacgcgcacggcgctgcgggagtgcgggcgaaatacggctggaccgacgtctcccgcttc
gccgcccgcggcgtccccgcggtgaacttcggcccgggcgacccgaatctggcgcacaag
cgtgacgagcgagtgccgctggcgcagatcacgcaggtgacggcgatgctgcgcagctac
ctcaccggcgcgtccagctga

DBGET integrated database retrieval system