KEGG   Nocardia cyriacigeorgica: NOCYR_4627Help
Entry
NOCYR_4627        CDS       T01756                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NOCYR_4627 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    NOCYR_4627 (fadA)
   00640 Propanoate metabolism
    NOCYR_4627 (fadA)
   00650 Butanoate metabolism
    NOCYR_4627 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    NOCYR_4627 (fadA)
   00072 Synthesis and degradation of ketone bodies
    NOCYR_4627 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NOCYR_4627 (fadA)
   00310 Lysine degradation
    NOCYR_4627 (fadA)
   00380 Tryptophan metabolism
    NOCYR_4627 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NOCYR_4627 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NOCYR_4627 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NOCYR_4627 (fadA)
Enzymes [BR:ncy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NOCYR_4627 (fadA)
Exosome [BR:ncy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NOCYR_4627 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
5088828..5090048
Genome map
AA seq 406 aa AA seqDB search
MPEAVIVSYARSPIGRAGKGSLVSMRPDDLATQMVRAALDKVPALDPAQIDDLMLGCGQP
GGEAGFNMAKVVATQLGYDFLPGVTLNRYCSSSLQTTRMALHAIKAGEGDVFISAGVETV
SRFPKGTSDGWPDTHNEKFAEAEARTVKRAEGGSDGWADPRESGELPDVYIAMGQTAENV
AQYTGISREDQDHWGVRSQNRAEEAIKAGFFEREITPVTLPDGTVVSTDDGPRPGTTYEK
ISQLKPVFRPDGTVTAGNACPLNDGAAALVIMSDTKAKELGLTPLARIVSTGVSGLSPEI
MGLGPIEAVRKALKIAGKTIDDIDLYEINEAFAVQVLGSARELNMDLDRLNVSGGAIALG
HPFGMTGARITATLINNLQTHDKQFGLETMCVGGGQGMAMIIERLS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggccgtcatcgtttcgtacgcccgctcccccatcggccgcgcaggcaagggt
tctctggtgagcatgcggccggacgacctcgccacccagatggtccgcgccgccctcgac
aaggtccccgcgctcgacccggcccagatcgacgatctgatgctcggctgcggccagccc
ggcggcgaggccggcttcaacatggccaaggtggtggccacccagctcggctacgacttc
ctgcccggcgtgaccctcaaccggtactgttcgtcgtcgctgcagaccacccgcatggcg
ctgcacgccatcaaggccggtgagggcgatgtgttcatctccgccggtgtggagaccgtc
tcgcgcttcccgaagggcacctccgacggctggcccgacacccacaacgagaagttcgcc
gaggccgaggcgcgcaccgtcaagcgcgccgagggcggctccgacggctgggccgacccg
cgcgagagcggcgagctgcccgacgtctacatcgcgatgggccagaccgccgagaacgtc
gcccagtacaccggcatctcgcgcgaggaccaggaccactggggcgtgcgttcgcagaac
cgcgccgaggaggccatcaaggccggcttcttcgagcgggagatcactccggtcaccctg
cccgacggcaccgtggtctccaccgacgacggcccccgccccggcaccacctacgagaag
atctcgcagctcaagccggtcttccgccccgacggcaccgtcaccgccggtaacgcctgc
ccgctcaacgacggcgccgccgccctggtgatcatgagcgacaccaaggccaaggagctg
ggcctgaccccgctggcccgcatcgtctccaccggtgtgtccggtctgtcgccggagatc
atgggcctcggcccgatcgaggccgtccgcaaggcgctgaagatcgccggcaagaccatc
gacgacatcgacctctacgagatcaacgaggccttcgcggtgcaggtgctcggctcggcc
cgcgagctgaacatggacctggaccggctcaacgtctccggcggcgccatcgccctcggc
cacccgttcggcatgaccggcgcccgcatcaccgcgacgctgatcaacaacctccagacc
cacgacaagcagttcggcctggagaccatgtgcgtcggcggcggccaaggcatggccatg
atcatcgagcgcctcagctga

DBGET integrated database retrieval system