KEGG   Nocardia cyriacigeorgica: NOCYR_4685Help
Entry
NOCYR_4685        CDS       T01756                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
ncy00900  Terpenoid backbone biosynthesis
ncy01100  Metabolic pathways
ncy01110  Biosynthesis of secondary metabolites
ncy01130  Biosynthesis of antibiotics
Module
ncy_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NOCYR_4685 (ispE)
Enzymes [BR:ncy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NOCYR_4685 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: CCF65440
UniProt: H6R0H1
Position
complement(5154037..5155008)
Genome map
AA seq 323 aa AA seqDB search
MGTVLSVVPSPVTVRAPSKVNLHLGVGDLRPDGYHDLTTVFQALSLSDDLEIAPAASLTV
RVTGEGAGEVPTDRTNLVWKAAVRLAHLAGRAPLVEISISKGIPVAGGMAGGSADAAATL
VGLNELWDLGLSREELTAVAAELGSDVPFSLHGGTALGTGRGERLLPVLSRNTFHWVIAL
AKGGLSTPAVYHELDRLREIGDPPRLGAPQELMQALASGDPKQLAPLLGNDLQAAAVSLK
PELRRTLRAGVSAGALAGLVSGSGPTCAFLCESEESAVQVAAELAGAGVSRSVRTATGPV
PGARVVGGEGPHPQPWREGGNIG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
ttgggcaccgtgctgtccgttgtgccgagccctgtcaccgtgcgtgcgccgtcgaaggtg
aacctccatctcggagtcggtgacctgcgccccgacgggtaccacgatctcaccaccgtg
ttccaggcgctgtcgctcagcgacgatctcgagatcgcgcccgcggcctcgctgacggtg
cgcgtcaccggtgagggcgccggcgaggtgcccaccgaccgcaccaatctggtgtggaag
gccgccgtgcggctggcccatctggccgggcgggcgccgctggtggagatctcgatcagc
aagggcatcccggtggccggcggcatggccggtggcagcgccgatgccgccgccaccctg
gtcggattgaacgaactgtgggatctgggtctttcccgcgaggaactcaccgcggtggcc
gccgaactcggcagcgacgtcccgttctcgctgcacggcggcaccgcgctcggcaccgga
cgcggcgagcggctgctgccggtgttgtcgcgcaacactttccactgggtgatcgcgctg
gccaagggcggactgtccaccccggccgtctaccacgagctggaccggttgcgtgagatc
ggcgatccgccgcgcctcggcgcaccgcaggaactcatgcaggccttggcttccggtgat
cccaaacaactcgccccgctgctcggcaacgacctccaggcggcggcggtgtcgctcaag
cccgaactgcgccgcaccctgcgggccggggtgagcgccggcgcactggccggcctggtc
tccggctcagggccgacgtgtgcgttcctgtgcgaatcggaggaatccgccgtccaggtg
gcggcggaactggccggtgccggggtgagccgcagcgtgcgcacggccaccggcccggtc
cccggcgcccgcgtggtcggcggcgaggggccgcatccgcagccgtggcgcgagggcggc
aatatcggctga

DBGET integrated database retrieval system