KEGG   Nocardia cyriacigeorgica: NOCYR_4729Help
Entry
NOCYR_4729        CDS       T01756                                 

Definition
putative UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ncy  Nocardia cyriacigeorgica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ncy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NOCYR_4729
   00052 Galactose metabolism
    NOCYR_4729
   00500 Starch and sucrose metabolism
    NOCYR_4729
   00520 Amino sugar and nucleotide sugar metabolism
    NOCYR_4729
Enzymes [BR:ncy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NOCYR_4729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5227127..5228086)
Genome map
AA seq 319 aa AA seqDB search
MTAKAGEPGTTTGAAMESCFRTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAE
AADSGADRLVIVTSPGKDGVVAHFVEDLVLESTLAERGKFHLLEKVRKAPGLLDVTSVVQ
EEPLGLGHAIAQVESALDADEDAIAVLLPDDLVLPCGVLDAMSRVRRERGGSVLCAIDVP
KDQVSAYGVFDVEPVPGVADPDVLRVNGMVEKPALADAPSTYAAAGRYLLDRQIFDALRR
IEPGTGGELQVTDAIALLIAEGHPVHVVVHRGSRHDLGNPGGYLRAAVDFALEREEYGPA
LREWLQHRLGPDWDPQVST
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgaaggcaggcgagcccggcacgacgacgggcgcggcgatggagtcgtgcttc
cgtaccgcggtcgtgcccgcggcggggctcgggacccgattcctgcccgcgaccaagacg
gtgcccaaggagttgctgccggtcgtcgatacccccggcatcgaactggtggccgccgaa
gccgccgactccggcgccgaccggctggtcatcgtcacctcgccgggcaaagacggcgtg
gtcgcgcatttcgtcgaggacctggtgctggagagcaccctcgccgaacgcggcaaattc
catctgctggagaaggtgcgcaaggcgccgggcctgctcgatgtcacctcggtggtgcag
gaggagccgctcggcctcgggcacgcgatcgcgcaggtcgaatccgcgctcgacgccgac
gaggacgccatcgcggtgctgctgcccgacgatctggtgctgccgtgcggtgtgctcgac
gcgatgagccgggtgcggcgcgagcgcggcggttcggtgctgtgcgccatcgacgtgccc
aaggaccaggtgagcgcctacggcgtcttcgacgtggagccggtgcccggcgtcgccgat
ccggatgtgttgcgcgtcaatgggatggtggagaagccggcgctggccgacgcgccgtcc
acctacgccgcggccgggcggtacctgctcgaccggcagatcttcgacgcgctgcgccgg
atcgagccgggcacgggcggggaactccaggtgaccgacgcgatcgcgctgctgatcgcc
gaggggcatccggtgcatgtggtggttcaccgtgggtcgcgccacgatctgggcaacccg
ggcggctatcttcgtgctgcggtggatttcgcgttggagcgggaggaatacggcccggca
ctgcgcgaatggttgcagcatcggctgggccccgactgggatccgcaggtgagcacgtag

DBGET integrated database retrieval system